Overview

Description

  • Nature
    Synthetic
  • Source
    Synthetic
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKG QRCLNPKSKQ ARLIIKKVERKNF-Linker-K
    • Molecular weight
      9 kDa
    • Amino acids
      22 to 94
  • Conjugation
    Biotin

Associated products

Specifications

Our Abpromise guarantee covers the use of ab176030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

  • Form
    Lyophilised
  • Additional notes

    Biotin incorporated at indicated position in a molar ratio of biotin:peptide of 1:1. Linker used is 8-amino-3,6-dioxaoctanoic acid.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    It is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 µmol/L. Stock solutions with up to 30% DMSO/water can also be prepared.

General Info

  • Alternative names
    • b R1
    • b-R1
    • Beta-R1
    • betaR1
    • C-X-C motif chemokine 11
    • Chemokine (C-X-C motif) ligand 11
    • Chemokine C-X-C motif ligand 11
    • CXC11
    • CXCL11
    • CXL11_HUMAN
    • H174
    • I TAC
    • I-TAC
    • Interferon gamma inducible protein 9
    • Interferon gamma-inducible protein 9
    • Interferon inducible T cell alpha chemoattractant
    • Interferon-inducible T-cell a chemoattractant I-TAC
    • Interferon-inducible T-cell alpha chemoattractant
    • IP 9
    • IP-9
    • IP9
    • ITAC
    • MGC102770
    • SCYB11
    • SCYB9B
    • Small inducible cytokine B11
    • Small inducible cytokine subfamily B (Cys-X-Cys) member 11
    • Small inducible cytokine subfamily B (Cys-X-Cys) member 9B
    • Small inducible cytokine subfamily B, member 11
    • Small inducible cytokine subfamily B, member 9B
    • Small-inducible cytokine B11
    see all
  • Function
    Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses.
  • Tissue specificity
    High levels in peripheral blood leukocytes, pancreas and liver astrocytes. Moderate levels in thymus, spleen and lung. Low levels in placenta, prostate and small intestine. Also found in epidermal basal layer keratinocytes in skin disorders.
  • Sequence similarities
    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab176030 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176030.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up