Synthetic Human Eotaxin protein (Biotin) (ab176066)

Overview

Description

  • Nature
    Synthetic
  • Source
    Synthetic
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAKDIC ADPKKKWVQDSMKYLDQKSPTPK(Linker-Biotin)P
    • Molecular weight
      9 kDa
    • Amino acids
      24 to 97
    • Additional sequence information
      Mature protein.
  • Conjugation
    Biotin

Associated products

Specifications

Our Abpromise guarantee covers the use of ab176066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    It is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 µmol.L-1. Stock solutions with up to 30% DMSO/water can also be prepared.

General Info

  • Alternative names
    • C-C motif chemokine 11
    • CCL 11
    • CCL11
    • CCL11_HUMAN
    • chemokine (C-C motif) ligand 11
    • Chemokine C C motif ligand 11
    • Chemokine CC Motif Ligand 11
    • Chemokine ligand 11
    • Eosinophil chemotactic protein
    • Eotaxin
    • eotaxin-1
    • MGC22554
    • SCYA 11
    • SCYA11
    • Small inducible cytokine A11
    • Small inducible cytokine subfamily A (Cys Cys) member 11
    • small inducible cytokine subfamily A (Cys-Cys), member 11 (eotaxin)
    • Small inducible cytokine subfamily A member 11
    • Small-inducible cytokine A11
    see all
  • Function
    In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3.
  • Sequence similarities
    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications
    O-linked glycan consists of a Gal-GalNAc disaccharide which is mofified with up to 2 sialic acid residues.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab176066 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176066.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up