Synthetic Human IL8 protein (Animal Free) (ab175169)
Key features and details
- Expression system: Synthetic
- Suitable for: HPLC
Description
-
Product name
Synthetic Human IL8 protein (Animal Free)
See all IL-8 proteins and peptides -
Expression system
Synthetic -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Synthetic -
-
Species
Human -
Sequence
AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSD GRELCLDPKENWVQRVVEK FLKRAENS -
Predicted molecular weight
9 kDa -
Amino acids
23 to 99
-
-
Description
Synthetic Human IL-8 protein
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab175169 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: Water
Lyophilized from water/acetonitrile/TFA to generate the TFA salt form. -
ReconstitutionIt is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 µmol.L-1. Stock solutions with up to 30% DMSO/water can also be prepared.
General Info
-
Alternative names
- (Ala-IL-8)77
- (Ser-IL-8)72
- 9E3
see all -
Function
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. -
Sequence similarities
Belongs to the intercrine alpha (chemokine CxC) family. -
Post-translational
modificationsSeveral N-terminal processed forms are produced by proteolytic cleavage after secretion from at least peripheral blood monocytes, leukcocytes and endothelial cells. In general, IL-8(1-77) is referred to as interleukin-8. IL-8(6-77) is the most promiment form. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab175169 has not yet been referenced specifically in any publications.