Overview

Description

  • Nature
    Synthetic
  • Source
    Synthetic
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGE KRCLNPESKAIKNLLKAVSK ERSKRSP
    • Molecular weight
      9 kDa
    • Amino acids
      22 to 98
    • Additional sequence information
      Mature protein.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab175163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    It is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 µmol.L-1. Stock solutions with up to 30% DMSO/water can also be prepared.

General Info

  • Alternative names
    • Interferon gamma induced factor MOB1, mouse, homolog of
    • Interferon gamma induced protein 10
    • 10 kDa interferon gamma induced protein
    • 10 kDa interferon gamma-induced protein
    • C X C motif chemokine 10
    • C7
    • Chemokine (C X C motif) ligand 10
    • Chemokine CXC motif ligand 10
    • Crg 2
    • CRG2
    • CXCL10
    • CXCL10(1-73)
    • CXL10_HUMAN
    • Gamma IP10
    • Gamma-IP10
    • gIP 10
    • GIP10
    • IFI10
    • INP 10
    • INP10
    • Interferon activated gene 10
    • Interferon gamma induced cell line
    • Interferon inducible cytokine IP 10
    • Interferon inducible cytokine IP10
    • IP 10
    • IP-10
    • Mob 1
    • MOB1
    • Protein 10 from interferon (gamma) induced cell line
    • SCYB10
    • Small inducible cytokine B10
    • Small inducible cytokine B10 precursor
    • Small inducible cytokine subfamily B (Cys X Cys) member 10
    • Small inducible cytokine subfamily B CXC member 10
    • Small inducible cytokine subfamily B, member 10
    • Small-inducible cytokine B10
    see all
  • Function
    Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
  • Sequence similarities
    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications
    CXCL10(1-73) is produced by proteolytic cleavage after secretion from keratinocytes.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab175163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up