Overview

Description

  • Nature
    Synthetic
  • Source
    Synthetic
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAIC SDPNNKRVKNAVKYLQSLERS
    • Molecular weight
      8 kDa
    • Amino acids
      24 to 94
    • Additional sequence information
      The sequence contains the full length mature protein minus the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab175150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    It is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 µmol/L. Stock solutions with up to 30% DMSO/water can also be prepared.

General Info

  • Alternative names
    • A-152E5.3
    • A152E53
    • ABCD 2
    • ABCD2
    • C-C motif chemokine 17
    • CC chemokine TARC
    • CCL17
    • CCL17_HUMAN
    • Chemokine CC Motif Ligand 17
    • MGC138271
    • MGC138273
    • SCYA17
    • Small Inducible Cytokine A17
    • Small Inducible Cytokine A17 Precursor
    • Small Inducible Cytokine Subfamily A (Cys Cys)
    • Small Inducible Cytokine Subfamily A (Cys Cys) Member 17
    • Small-inducible cytokine A17
    • T Cell Directed CC Chemokine
    • Thymus and activation regulated chemokine
    • Thymus and activation-regulated chemokine
    see all
  • Function
    Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4.
  • Tissue specificity
    Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.
  • Sequence similarities
    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab175150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up