Synthetic Human TARC/CCL17 protein (Animal Free) (ab175150)
Key features and details
- Expression system: Synthetic
- Suitable for: HPLC
Description
-
Product name
Synthetic Human TARC/CCL17 protein (Animal Free)
See all TARC/CCL17 proteins and peptides -
Expression system
Synthetic -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Synthetic -
-
Species
Human -
Sequence
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAIC SDPNNKRVKNAVKYLQSLERS -
Predicted molecular weight
8 kDa -
Amino acids
24 to 94 -
Additional sequence information
The sequence contains the full length mature protein minus the signal peptide.
-
-
Description
Synthetic Human TARC/CCL17 protein
Specifications
Our Abpromise guarantee covers the use of ab175150 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
-
Form
Lyophilized -
Additional notes
This product was previously labelled as TARC
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Lyophilized from water/acetonitrile/TFA to generate the TFA salt form.
-
ReconstitutionIt is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 µmol/L. Stock solutions with up to 30% DMSO/water can also be prepared.
General Info
-
Alternative names
- A-152E5.3
- A152E53
- ABCD 2
see all -
Function
Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4. -
Tissue specificity
Expressed at high levels in thymus and at low levels in the lung, colon and small intestine. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab175150 has not yet been referenced specifically in any publications.