Overview

  • Product name

    Synthetic Mouse DEFB114 protein
  • Protein length

    Full length protein

Description

  • Nature

    Synthetic
  • Source

    Synthetic
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK
    • Molecular weight

      5 kDa
    • Amino acids

      23 to 67
    • Additional sequence information

      Modifications: Disulphide bridge

Specifications

Our Abpromise guarantee covers the use of ab175156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    It is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 µmol/L. Stock solutions with up to 30% DMSO/water can also be prepared.

General Info

  • Alternative names

    • Beta defensin 14
    • Beta-defensin 114
    • DEFB-14
    • DEFB14
    • Defensin beta 114
    • Defensin beta 14
    see all
  • Cellular localization

    Secreted

References

ab175156 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up