Overview

  • Product name

  • Description

    Rabbit polyclonal to SYT11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SYT11 aa 44-117.
    Sequence:

    AEKKQKNPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRN LLVDAAEAGLLSRDKDPRGPSSGS


    Database link: Q9BT88

  • Positive control

    • Human cerebral cortex tissue; RT4 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500. Predicted molecular weight: 48 kDa.

Target

  • Function

    May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis.
  • Sequence similarities

    Belongs to the synaptotagmin family.
    Contains 2 C2 domains.
  • Post-translational
    modifications

    Ubiquitinated and targeted to the proteasome complex for degradation.
  • Cellular localization

    Membrane. Cell junction > synapse. Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. In substantia nigra, observed in neuronal cell bodies and neurites. Found in the core of the Lewy bodies in the brain of sporadic Parkinson disease patients.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp781D015 antibody
    • KIAA0080 antibody
    • MGC10881 antibody
    • MGC17226 antibody
    • Synaptotagmin 11 antibody
    • Synaptotagmin 12 antibody
    • Synaptotagmin XI antibody
    • Synaptotagmin-11 antibody
    • Synaptotagmin11 antibody
    • Synaptotagmin12 antibody
    • SynaptotagminXI antibody
    • SYT 11 antibody
    • SYT 12 antibody
    • Syt XI antibody
    • Syt11 antibody
    • SYT11_HUMAN antibody
    • SYT12 antibody
    • SytXI antibody
    see all

Images

  • Anti-SYT11 antibody (ab204589) at 1/250 dilution + RT4 cell lysate

    Predicted band size: 48 kDa

  • Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue labeling SYT11 with ab204589 at 1/1000 dilution.

References

ab204589 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up