Overview

  • Product name

    Anti-SYTL5 antibody
  • Description

    Rabbit polyclonal to SYTL5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human SYTL5 aa 600-650 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    TAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFMFSGIH P


    Database link: Q8TDW5

  • Positive control

    • Rat brain tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab203218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 82 kDa.
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue, labeling SYTL5 (red) with ab203218 at 1/200 dilution. Cy3-conjugated goat anti-rabbit IgG was used as a secondary antibody at 1/200 dilution for 40 minutes at 37°C.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue, labeling SYTL5 with ab203218 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab203218 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up