Overview

  • Product name

    Anti-T Plastin/PLS3 antibody
    See all T Plastin/PLS3 primary antibodies
  • Description

    Rabbit polyclonal to T Plastin/PLS3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat, Cow, Chinese hamster
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human T Plastin/PLS3 aa 379-630. (Expressed in E.coli).
    Sequence:

    ALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALV ILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSL VGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWV NRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLT EDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMK RV


    Database link: P13797

  • Positive control

    • WB: Pig liver and heart lysate; Mouse liver lysate; Recombinant human T Plastin/PLS3 protein. IHC-P: Human prostate cancer, stomach cancer and rectum cancer tissue.
  • General notes

     This product was previously labelled as T Plastin

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 71 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human rectum cancer tissue stained for T Plastin/PLS3 using ab233104 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for T Plastin/PLS3 using ab233104 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for T Plastin/PLS3 using ab233104 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-T Plastin/PLS3 antibody (ab233104) at 2 µg/ml

    Lane 1 : Pig liver tissue
    Lane 2 : Pig heart tissue
    Lane 3 : Mouse liver tissue

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 71 kDa

  • Anti-T Plastin/PLS3 antibody (ab233104) at 2 µg/ml + Recombinant human T Plastin/PLS3 protein

    Predicted band size: 71 kDa

References

ab233104 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233104.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up