Anti-T54 antibody (ab224315)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-T54 antibody
See all T54 primary antibodies -
Description
Rabbit polyclonal to T54 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human T54 aa 223-338.
Sequence:MPRPDEEQEKDKEDQPQGLVPGGAVVVLSGPHRGLYGKVEGLDPDNVRAM VRLAVGSRVVTVSEYYLRPVSQQEFDKNTLDLRQQNGTASSRKTLWNQEL YIQQDNSERKRKHLPD
Database link: Q92917 -
Positive control
- WB: A549 cell lysate. ICC/IF: U-2 OS cells. IHC-P: Human fallopian tube tissue.
-
General notes
Previously labelled as GPKOW.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab224315 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | 1/250 - 1/500. Predicted molecular weight: 52 kDa. |
Target
-
Sequence similarities
Belongs to the MOS2 family.
Contains 1 G-patch domain.
Contains 2 KOW domains. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 27238 Human
- SwissProt: Q92917 Human
- Unigene: 503666 Human
-
Alternative names
- G patch domain and KOW motifs antibody
- G patch domain and KOW motifs containing protein antibody
- G patch domain and KOW motifs-containing protein antibody
see all
Images
-
Western blot - Anti-T54 antibody (ab224315)Anti-T54 antibody (ab224315) at 1/250 dilution + A549 (human lung carcinoma cell line) cell lysate
Predicted band size: 52 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-T54 antibody (ab224315)Paraffin embedded human fallopian tube tissue stained for T54 with ab224315 (1/50 dilution) in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-T54 antibody (ab224315)PFA-fixed/Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for T54 (green) using ab224315 (4 µg/ml) in ICC/IF.
Protocols
Datasheets and documents
References
ab224315 has not yet been referenced specifically in any publications.
