Anti-T54 antibody (ab224315)
Key features and details
- Rabbit polyclonal to T54
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-T54 antibody
See all T54 primary antibodies -
Description
Rabbit polyclonal to T54 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human T54 aa 223-338.
Sequence:MPRPDEEQEKDKEDQPQGLVPGGAVVVLSGPHRGLYGKVEGLDPDNVRAM VRLAVGSRVVTVSEYYLRPVSQQEFDKNTLDLRQQNGTASSRKTLWNQEL YIQQDNSERKRKHLPD
Database link: Q92917 -
Positive control
- WB: A549 cell lysate. ICC/IF: U-2 OS cells. IHC-P: Human fallopian tube tissue.
-
General notes
Previously labelled as GPKOW.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab224315 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 52 kDa. |
Target
-
Sequence similarities
Belongs to the MOS2 family.
Contains 1 G-patch domain.
Contains 2 KOW domains. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 27238 Human
- SwissProt: Q92917 Human
- Unigene: 503666 Human
-
Alternative names
- G patch domain and KOW motifs antibody
- G patch domain and KOW motifs containing protein antibody
- G patch domain and KOW motifs-containing protein antibody
see all
Images
-
Anti-T54 antibody (ab224315) at 1/250 dilution + A549 (human lung carcinoma cell line) cell lysate
Predicted band size: 52 kDa -
Paraffin embedded human fallopian tube tissue stained for T54 with ab224315 (1/50 dilution) in immunohistochemical analysis.
-
PFA-fixed/Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for T54 (green) using ab224315 (4 µg/ml) in ICC/IF.
Protocols
Datasheets and documents
References (0)
ab224315 has not yet been referenced specifically in any publications.