Overview

  • Product name

    Anti-TACC1 antibody
  • Description

    Rabbit polyclonal to TACC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide corresponding to Human TACC1 aa 11-60 (N terminal). NP_006274.2.
    Sequence:

    PVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGN


    Database link: O75410

  • Positive control

    • Human placenta tissue; MCF7 cells; K562 cell extract.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 0.87% Sodium chloride, 50% Glycerol, 49% PBS

    PBS (without Mg2+, Ca2+)
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab211478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 88 kDa.
ICC/IF 1/100 - 1/500.
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Function

    Likely involved in the processes that promote cell division prior to the formation of differentiated tissues.
  • Tissue specificity

    Isoform 1, isoform 3 and isoform 5 are ubiquitous. Isoform 2 is strongly expressed in the brain, weakly detectable in lung and colon, and overexpressed in gastric cancer. Isoform 4 is not detected in normal tissues, but strong expression was found in gastric cancer tissues. Down-regulated in a subset of cases of breast cancer.
  • Sequence similarities

    Belongs to the TACC family.
    Contains 2 SPAZ (Ser/Pro-rich AZU-1) domains.
  • Developmental stage

    Expressed at high level during early embryogenesis.
  • Post-translational
    modifications

    Isoform 1 is heavily phosphorylated; isoform 6 is not. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Nucleus. Cytoplasm > cytoskeleton > centrosome. Nucleus during interphase. Weakly concentrated at centrosomes during mitosis and colocalizes with AURKC at the midbody during cytokinesis.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp686K18126 antibody
    • Ga 55 antibody
    • Ga55 antibody
    • Gastric cancer antigen Ga 55 antibody
    • Gastric cancer antigen Ga55 antibody
    • KIAA1103 antibody
    • TACC 1 antibody
    • Tacc1 antibody
    • TACC1_HUMAN antibody
    • Taxin 1 antibody
    • Taxin-1 antibody
    • Taxin1 antibody
    • Transforming acidic coiled coil containing protein 1 antibody
    • Transforming acidic coiled-coil-containing protein 1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human plancenta tissue labeling TACC1 with ab211478 at 10µg/mL.

  • Immunofluorescent analysis of MCF7 cells labeling TACC1 with ab211478 at 1/100 dilution. The image on the right is treated with the synthesized peptide.

  • All lanes : Anti-TACC1 antibody (ab211478) at 1/500 dilution

    Lane 1 : K562 cell extract
    Lane 2 : K562 cell extract with synthesized peptide

    Predicted band size: 88 kDa

References

ab211478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up