Overview

  • Product name

  • Description

    Rabbit polyclonal to TACC3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TACC3 aa 133-268.
    Sequence:

    SPAFGSGSSSESGPGALADLDCSSSSQSPGSSENQMVSPGKVSGSPEQAV EENLSSYSLDRRVTPASETLEDPCRTESQHKAETPHGAEEECKAETPHGA EEECRHGGVCAPAAVATS PPGAIPKEACGGAPLQGL


    Database link: Q9Y6A5

  • Positive control

    • IHC-P: Human tonsil and testis tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Plays a role in the microtubule-dependent coupling of the nucleus and the centrosome. Involved in the processes that regulate centrosome-mediated interkinetic nuclear migration (INM) of neural progenitors (By similarity). May be involved in the control of cell growth and differentiation. May contribute to cancer.
  • Sequence similarities

    Belongs to the TACC family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ERIC 1 antibody
    • ERIC-1 antibody
    • ERIC1 antibody
    • MGC117382 antibody
    • MGC133242 antibody
    • OTTHUMP00000113796 antibody
    • TACC3 antibody
    • TACC3_HUMAN antibody
    • Transforming acidic coiled coil containing protein 3 antibody
    • Transforming acidic coiled-coil-containing protein 3 antibody
    see all

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling TACC3 using ab235929 at 1/100 dilution in ICC/IF. Secondary antibody was Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

  • Paraffin-embedded human tonsil tissue stained for TACC3 using ab235929 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for TACC3 using ab235929 at 1/100 dilution in immunohistochemical analysis.

References

ab235929 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up