Anti-TADA3L antibody (ab254869)
Key features and details
- Rabbit polyclonal to TADA3L
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-TADA3L antibody
See all TADA3L primary antibodies -
Description
Rabbit polyclonal to TADA3L -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow, Orangutan -
Immunogen
Recombinant fragment corresponding to Human TADA3L aa 370-432.
Sequence:LAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKT LKERESILKLLDG
Database link: O75528 -
Positive control
- IHC-P: Human vagina tissue. WB: RT4, NIH/3T3, NBT-II and U-251 MG cell lysate. ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab254869 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
WB | Use a concentration of 0.04 - 0.4 µg/ml. | |
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
TADA3L functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. TADA3L is also known as a coactivator for p53/TP53-dependent transcriptional activation. The PCAF complex is composed of a number of TBP-associated factors (TAFS), such as TAF5, TAF5L, TAF6, TAF6L, TAF9, TAF10 and TAF12, PCAF, and also PCAF-associated factors (PAFs), such as TADA2L/ADA2, TADA3L/ADA3 and SPT3. -
Cellular localization
Nuclear -
Database links
- Entrez Gene: 510184 Cow
- Entrez Gene: 10474 Human
- Entrez Gene: 101206 Mouse
- Entrez Gene: 100174678 Orangutan
- Entrez Gene: 362414 Rat
- Omim: 602945 Human
- SwissProt: Q5EAE2 Cow
- SwissProt: O75528 Human
see all -
Alternative names
- ADA3 antibody
- ADA3 homolog antibody
- ADA3-like protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TADA3L antibody (ab254869)Paraffin-embedded human vagina tissue stained for TADA3L using ab254869 at 1/50 dilution in immunohistochemical analysis.
-
All lanes : Anti-TADA3L antibody (ab254869) at 0.4 µg/ml
Lane 1 : NIH/3T3 cell lysate
Lane 2 : NBT-II cell lysate -
Lanes 2-3 : Anti-TADA3L antibody (ab254869) at 0.4 µg/ml
Lane 1 : DNA Ladder
Lane 2 : RT4 cell lysate
Lane 3 : U-251 MG cell lysate -
PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling TADA3L using ab254869 at 4µg/ml (green) in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab254869 has not yet been referenced specifically in any publications.