Anti-TADA3L antibody (ab254869)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-TADA3L antibody
See all TADA3L primary antibodies -
Description
Rabbit polyclonal to TADA3L -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow, Orangutan
-
Immunogen
Recombinant fragment corresponding to Human TADA3L aa 370-432.
Sequence:LAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKT LKERESILKLLDG
Database link: O75528 -
Positive control
- IHC-P: Human vagina tissue. WB: RT4, NIH/3T3, NBT-II and U-251 MG cell lysate. ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab254869 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
|
| WB | Use a concentration of 0.4 µg/ml. | |
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
TADA3L functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. TADA3L is also known as a coactivator for p53/TP53-dependent transcriptional activation. The PCAF complex is composed of a number of TBP-associated factors (TAFS), such as TAF5, TAF5L, TAF6, TAF6L, TAF9, TAF10 and TAF12, PCAF, and also PCAF-associated factors (PAFs), such as TADA2L/ADA2, TADA3L/ADA3 and SPT3. -
Cellular localization
Nuclear -
Database links
- Entrez Gene: 510184 Cow
- Entrez Gene: 10474 Human
- Entrez Gene: 101206 Mouse
- Entrez Gene: 100174678 Orangutan
- Entrez Gene: 362414 Rat
- Omim: 602945 Human
- SwissProt: Q5EAE2 Cow
- SwissProt: O75528 Human
see all -
Alternative names
- ADA3 antibody
- ADA3 homolog antibody
- ADA3-like protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TADA3L antibody (ab254869)Paraffin-embedded human vagina tissue stained for TADA3L using ab254869 at 1/50 dilution in immunohistochemical analysis. -
Western blot - Anti-TADA3L antibody (ab254869)All lanes : Anti-TADA3L antibody (ab254869) at 0.4 µg/ml
Lane 1 : NIH/3T3 cell lysate
Lane 2 : NBT-II cell lysate -
Western blot - Anti-TADA3L antibody (ab254869)Lanes 2-3 : Anti-TADA3L antibody (ab254869) at 0.4 µg/ml
Lane 1 : DNA Ladder
Lane 2 : RT4 cell lysate
Lane 3 : U-251 MG cell lysate -
Immunocytochemistry/ Immunofluorescence - Anti-TADA3L antibody (ab254869)PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling TADA3L using ab254869 at 4µg/ml (green) in ICC/IF.
Datasheets and documents
References
ab254869 has not yet been referenced specifically in any publications.
