Overview

  • Product name

    Anti-TAF1 48 antibody
  • Description

    Rabbit polyclonal to TAF1 48
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TAF1 48 aa 68-159.
    Sequence:

    HQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMES FNTFANRMKNIGVMNYLKISLQHALYLLHHGMLKDAKRNLSE


    Database link: Q15573

  • Positive control

    • Human cerebral cortex tissue; U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC:17061 antibody
    • RAFI48 antibody
    • RNA polymerase I-specific TBP-associated factor 48 kDa antibody
    • SL1 48kD subunit antibody
    • SL1 antibody
    • Taf1a antibody
    • TAF1A_HUMAN antibody
    • TAFI48 antibody
    • TATA box binding protein (TBP) associated factor RNA polymerase I, A 48kDa antibody
    • TATA box binding protein (Tbp)-associated factor, RNA polymerase I, A antibody
    • TATA box binding protein associated factor 1A antibody
    • TATA box binding protein associated factor RNA polymerase I subunit A antibody
    • TATA box-binding protein-associated factor 1A antibody
    • TATA box-binding protein-associated factor RNA polymerase I subunit A antibody
    • TBP associated factor RNA polymerase I 48 kDa antibody
    • TBP-associated factor 1A antibody
    • Transcription factor SL1 antibody
    • Transcription initiation factor SL1/TIF-IB subunit A antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue labeling TAF1 48 with ab188066 at 1/500 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling TAF1 48 with ab188066 at 4 µg/ml.

References

ab188066 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188066.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up