Overview

  • Product name

  • Description

    Rabbit polyclonal to TAF11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human TAF11 aa 1-211.
    Sequence:

    MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKE AAAEEGELESQDVSDLTTVEREDSSLLNPAAKKLKIDTKEKKEKKQKVDE DEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNV VIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQI PNSKHKKIIFF


    Database link: Q15544-1

  • Positive control

    • IHC-P: Human testis and skeletal muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Core TAFII present in both of the previously described TFIID species which either lack or contain TAFII30 (TFIID alpha and TFIID beta respectively).
  • Sequence similarities

    Belongs to the TAF11 family.
  • Domain

    TBP and TAFII18 bind to distinct domains of TAFII28.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC:15243 antibody
    • p30 beta antibody
    • PRO2134 antibody
    • TAF antibody
    • TAF(II)28 antibody
    • TAF11 antibody
    • TAF11 RNA polymerase II TATA box binding protein (TBP) associated factor 28 kD antibody
    • TAF11_HUMAN antibody
    • TAF2I antibody
    • TAFII 28 antibody
    • TAFII-28 antibody
    • TAFII28 antibody
    • TFIID subunit p30 beta antibody
    • TFIID subunit p30-beta antibody
    • Transcription initiation factor TFIID 28 kDa subunit antibody
    • Transcription initiation factor TFIID subunit 11 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for TAF11 using ab234721 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skeletal muscle tissue stained for TAF11 using ab234721 at 1/100 dilution in immunohistochemical analysis.

References

ab234721 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up