Overview

  • Product name

    Anti-TAF13 antibody
  • Description

    Rabbit polyclonal to TAF13
  • Host species

    Rabbit
  • Specificity

    ab201090 detects endogenous levels of TAF13 protein.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human TAF13 aa 79-124.
    Sequence:

    GRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS


    Database link: Q15543

  • Positive control

    • HEK293T and H9C2 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab201090 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 14 kDa.

Target

  • Function

    TFIID beta-specific TAFII.
  • Sequence similarities

    Belongs to the TAF13 family.
    Contains 1 histone-fold domain.
  • Domain

    The binding of TAF10 and TAF11 requires distinct domains of TAF13.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC22425 antibody
    • TAF(II)18 antibody
    • taf13 antibody
    • TAF13 RNA polymerase II, TATA box binding protein (TBP) associated factor, 18kDa antibody
    • TAF13_HUMAN antibody
    • TAF2K antibody
    • TAFII 18 antibody
    • TAFII-18 antibody
    • TAFII18 antibody
    • Transcription initiation factor TFIID 18 kDa subunit antibody
    • Transcription initiation factor TFIID subunit 13 antibody
    see all

Images

  • All lanes : Anti-TAF13 antibody (ab201090)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : H9C2 whole cell lysate

    Predicted band size: 14 kDa

References

ab201090 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201090.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up