Overview

  • Product name

    Anti-TAF1B antibody
  • Description

    Rabbit polyclonal to TAF1B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human TAF1B aa 369-588.
    Sequence:

    LFLLDDSFEWSLSNLAEKHNEKNKKDKPWFDFRKWYQIMKKAFDEKKQKW EEARAKYLWKSEKPLYYSFVDKPVAYKKREMVVNLQKQFSTLVESTATAG KKSPSSFQFNWTEEDTDRTCFHGHSLQGVLKEKGQSLLTKNSLYWLSTQK FCRCYCTHVTTYEESNYSLSYQFILNLFSFLLRIKTSLLHEEVSLVEKKL FEKKYSVKRKKSRSKKVRRH


    Database link: Q53T94

  • Positive control

    • IHC-P: Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    TAF1B belongs to the family of TATA box binding protein (Tbp)-associated factors. Promoter selectivity for all three classes of eukaryotic RNA polymerases is brought about by multimeric protein complexes containing TATA box binding protein (TBP) and specific TBP-associated factors (TAFs).
  • Cellular localization

    Nuclear
  • Database links

    • Alternative names

      • MGC:9349 antibody
      • RAF1B antibody
      • RAFI63 antibody
      • SL1 antibody
      • TAB1 B antibody
      • TAF1B TATA box binding protein (TBP) associated factor, RNA polymerase I, B, 63kDa antibody
      • TAFI63 antibody
      • TATA box binding protein associated factor 1B antibody
      • TATA box binding protein associated factor RNA polymerase I subunit B antibody
      see all

    Images

    • Paraffin-embedded human colon cancer tissue stained for TAF1B using ab238759 at 1/100 dilution in immunohistochemical analysis.

    References

    ab238759 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab238759.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up