Overview

  • Product name

    Anti-TAF2 antibody
  • Description

    Rabbit polyclonal to TAF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken
  • Immunogen

    Recombinant fragment corresponding to Human TAF2 aa 400-450.
    Sequence:

    DKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMF Q


    Database link: Q6P1X5

  • Positive control

    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF2 is one of the larger subunits of TFIID that is stably associated with the TFIID complex. It contributes to interactions at and downstream of the transcription initiation site, interactions that help determine transcription complex response to activators.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • 150 kDa cofactor of initiator function antibody
    • 150kDa antibody
    • 4732460C16Rik antibody
    • AI425886 antibody
    • CIF150 antibody
    • Cofactor of initiator function, 150kD subunit antibody
    • MGC166014 antibody
    • RNA polymerase II TBP associated factor subunit B 3 antibody
    • RNA polymerase II TBP associated factor subunit B antibody
    • TAF(II)150 antibody
    • TAF2 RNA polymerase II, TATA box binding protein (TBP) associated factor antibody
    • TAF2 RNA polymerase II, TATA box binding protein (TBP) associated factor, 150kDa antibody
    • TAF2 RNA polymerase II, TATA box binding protein-associated factor, 150 KD antibody
    • TAF2B antibody
    • TAFII 150 antibody
    • TAFII150 antibody
    • TATA box binding protein (TBP) associated factor, RNA polymerase II, B, 150kD antibody
    • TATA box binding protein associated factor 2B antibody
    • TBP associated factor 150 kDa antibody
    • TBP associated factor, RNA polymerase II, 150 KD antibody
    • TBP-associated factor 2 antibody
    • Transcription initiation factor TFIID 150 kDa subunit antibody
    • Transcription initiation factor TFIID subunit 2 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for TAF2 using ab234722 at 1/100 dilution in immunohistochemical analysis.

References

ab234722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up