
  • Product name
    Anti-TAF4B antibody [TAFAD26A]
    See all TAF4B primary antibodies
  • Description
    Mouse monoclonal [TAFAD26A] to TAF4B
  • Host species
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Recombinant fragment
    Predicted to work with: Human
  • Immunogen

    Recombinant human TAF4B



Our Abpromise guarantee covers the use of ab50808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent dilution. Predicted molecular weight: 91 kDa.
ELISA Use at an assay dependent dilution.


  • Relevance
    TAF4B is a cell type-specific subunit of TFIID that may function as a gene-selective coactivator in certain cells. TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. It is composed of TATA binding protein (TBP) and a number of TBP-associated factors (TAFs). This protein is preferentially expressed in ovarian granulosa cells and is highly expressed in B cells.
  • Cellular localization
    Nucleus. Cytoplasm. Export into the cytoplasm is mediated by a CRM1-independent nuclear export pathway and not by phosphorylation.
  • Database links
  • Alternative names
    • TAF(II)105 antibody
    • TAF2C2 antibody
    • TAF4b RNA polymerase II, TATA box binding protein (TBP) associated factor, 105kDa antibody
    • TAFII 105 antibody
    • TAFII105 antibody
    • TAFII105ALPHA antibody
    • TATA box binding protein (TBP) associated factor 4B antibody
    • TATA box binding protein (TBP) associated factor, RNA polymerase II, C2, 105kD antibody
    • Transcription initiation factor TFIID 105 kD subunit antibody
    • Transcription initiation factor TFIID 105 kDa subunit antibody
    • Transcription initiation factor TFIID subunit 4B antibody
    see all


  • Anti-TAF4B antibody [TAFAD26A] (ab50808) + Recombinant TAF4B fragment

    Predicted band size: 91 kDa
    Observed band size: 32 kDa
    why is the actual band size different from the predicted?

    This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.


ab50808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As


Thank you for your enquiry. I can confirm that the immunogen sequence of TAF4B antibody is: CGQKTMPVNTIIPTSQFPPASILKQITLPGNKILSLQASPTQKNRIKENVTSCFRDEDDINDVTSMAGVNLNEENA CILATNSELVGTLIQSCKDEPFLFIGALQKRILDIGKKHDITELNSDAVNLISQAT I have tried a BLAST search using the sequence with TAF4B of mouse (accession#: XP_128905) and the results is as follows: Score = 206 bits (524), Expect = 3e-52 Identities = 106/134 (79%), Positives = 118/134 (88%), Gaps = 3/134 (2%) I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

Read More


Sign up