Overview

  • Product name

  • Description

    Rabbit polyclonal to TAF6L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TAF6L aa 304-384.
    Sequence:

    LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKA DGHKVYGAILVAVERLLKMKAQAAEPNRGGP


    Database link: Q9Y6J9

  • Positive control

    • Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    TAF6L is a protein that is a component of the PCAF histone acetylase complex and structurally similar to one of the histone-like TAFs, TAF6. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • CBP associated factor associated factor 65 kDa subunit 6L antibody
    • PAF65 alpha antibody
    • PAF65A antibody
    • PCAF associated factor 65 alpha antibody
    • TAF6 like RNA polymerase II p300/CBP associated factor associated factor 65 kDa subunit 6L antibody
    • TAF6-like RNA polymerase II p300 antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human testis tissue sections labeling TAF6L with ab204582 at a 1/20 dilution.

References

ab204582 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up