Overview

  • Product name

    Anti-TAF6L antibody - C-terminal
    See all TAF6L primary antibodies
  • Description

    Rabbit polyclonal to TAF6L - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide within Human TAF6L aa 570-619 (C terminal). The exact sequence is proprietary. NP_006464
    Sequence:

    GRRCRGRLFQTAFPAPYGPSPASRYVQKLPMIGRTSRPARRWALSDYSLY


    Database link: Q9Y6J9

  • Positive control

    • HeLa whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab179603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 68 kDa.

Target

Images

  • Anti-TAF6L antibody - C-terminal (ab179603) at 1 µg/ml + HeLa whole cell lysate at 10 µg

    Predicted band size: 68 kDa

References

ab179603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up