Overview

  • Product name

    Anti-TAF8/TBN antibody
  • Description

    Rabbit polyclonal to TAF8/TBN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Xenopus laevis, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human TAF8/TBN aa 85-154.
    Sequence:

    RTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKAL TAGQNRPHPPHIPSHFPEFP


    Database link: Q7Z7C8

  • Positive control

    • HEK lysate; Human placenta tissue; U-251 MG cells.
  • General notes

     This product was previously labelled as TAF8

     

Properties

Applications

Our Abpromise guarantee covers the use of ab204894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 34 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Transcription factor TFIID is one of the general factors required for accurate and regulated initiation by RNA polymerase II. Mediates both basal and activator-dependent transcription. Plays a role in the differentiation of preadipocyte fibroblasts to adipocytes, however, does not seem to play a role in differentiation of myoblasts. Required for the integration of TAF10 in the TAF complex. May be important for survival of cells of the inner cell mass which constitute the pluripotent cell population of the early embryo.
  • Sequence similarities

    Belongs to the TAF8 family.
    Contains 1 histone-fold domain.
  • Domain

    Ectopic expression of the histone fold domain acts as a dominant-negative mutant resulting in differentiation inhibition.
  • Cellular localization

    Nucleus. Cytoplasm. Localized in the cytoplasm and transported from the cytoplasm to the nucleus in some cells, possibly depending on the functional or developmental state of the cell.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ32821 antibody
    • hTAFII43 antibody
    • Protein taube nuss antibody
    • TAF(II)43 antibody
    • taf8 antibody
    • TAF8 RNA polymerase II, TATA box binding protein (TBP) associated factor, 43kDa antibody
    • TAF8_HUMAN antibody
    • TAFII-43 antibody
    • TAFII43 antibody
    • TATA box binding protein (TBP) associated factor, RNA polymerase II A 45/50kDa antibody
    • Taube nuss homolog (mouse) antibody
    • TBN antibody
    • TBP associated factor 8 antibody
    • TBP associated factor TAFII43 antibody
    • TBP associated factor, RNA polymerase II, 43 kD antibody
    • TBP-associated factor 43 kDa antibody
    • TBP-associated factor 8 antibody
    • Transcription initiation factor TFIID 43 kDa subunit antibody
    • Transcription initiation factor TFIID subunit 8 antibody
    see all

Images

  • All lanes : Anti-TAF8/TBN antibody (ab204894) at 1/100 dilution

    Lane 1 : Negative Control
    Lane 2 : HEK293 lysate

    Predicted band size: 34 kDa

  • Immunofluorescent analysis of U-251 MG cells (PFA-fixed/Triton X-100 permeabilized) labeling TAF8/TBN with ab204894 at 4 µg/ml (green).

  • Immunohistochemical analysis of paraffin-embedded Human placenta tissue labeling TAF8/TBN with ab204894 at 1/50 dilution.

References

ab204894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up