Overview

  • Product name

  • Description

    Rabbit polyclonal to TAF9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human TAF9 aa 1-264.
    Sequence:

    MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTI LDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRN QTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSV GSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVK ASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKRED DDDDDDDDDDYDNL


    Database link: Q16594

  • Positive control

    • IHC-P: Human thyroid and skin tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab234758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    TAF9 functions as a component of the DNA-binding general transcription factor complex TFIID and the regulatory transcription complex SAGA. Binding of TFIID to a promoter (with or without TATA element) is the initial step in pre-initiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription. SAGA influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (SPT3 and SPT8) and promoter selectivity, interaction with transcription activators (GCN5, ADA2, ADA3, and TRA1), and chromatin modification through histone acetylation (GCN5).
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • TAF9 RNA polymerase II, TATA box-binding protein-associated factor, 32kDa antibody
    • MGC:1603 antibody
    • MGC:3647 antibody
    • MGC:5067 antibody
    • RNA polymerase II TBP-associated factor subunit G antibody
    • STAF31/32 antibody
    • TAF17 antibody
    • TAF2G antibody
    • TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa antibody
    • TAFII31 antibody
    • TAFII32 antibody
    • TAFIID32 antibody
    • TATA box-binding protein-associated factor 2G antibody
    • TBP associated factor 17 kDa antibody
    • TBP associated factor 9 antibody
    • TBP associated factor, RNA polymerase II, 32-KD antibody
    • transcription initiation factor TFIID 31 kD subunit antibody
    • transcription initiation factor TFIID 31 kDa subunit antibody
    • transcription initiation factor TFIID 32 kDa subunit antibody
    • Transcription initiation factor TFIID subunit 9 antibody
    see all

Images

  • Paraffin-embedded human thyroid tissue stained for TAF9 using ab234758 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for TAF9 using ab234758 at 1/100 dilution in immunohistochemical analysis.

References

ab234758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up