Overview

  • Product name

    Anti-Tafazzin / TAZ antibody
    See all Tafazzin / TAZ primary antibodies
  • Description

    Rabbit polyclonal to Tafazzin / TAZ
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human Tafazzin/ TAZ aa 213-290.
    Sequence:

    WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEM RKALTDFIQEEFQHLKTQAEQLHNHLQP


    Database link: Q16635

  • Positive control

    • IHC-P: Human heart muscle tissue. WB: Tafazzin / TAZ overexpression HEK-293T cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224655 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Some isoforms may be involved in cardiolipin (CL) metabolism.
  • Tissue specificity

    High levels in cardiac and skeletal muscle. Up to 10 isoforms can be present in different amounts in different tissues. Most isoforms are ubiquitous. Isoforms that lack the N-terminus are found in leukocytes and fibroblasts, but not in heart and skeletal muscle. Some forms appear restricted to cardiac and skeletal muscle or to leukocytes.
  • Involvement in disease

    Barth syndrome
  • Sequence similarities

    Belongs to the taffazin family.
  • Domain

    The hydrophilic domain may serve as an exposed loop interacting with other proteins.
  • Cellular localization

    Cytoplasm and Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Barth syndrome antibody
    • BTHS antibody
    • Cardiomyopathy dilated 3A (X linked) antibody
    • CMD3A antibody
    • EFE antibody
    • EFE2 antibody
    • Endocardial fibroelastosis 2 antibody
    • G4.5 antibody
    • LVNCX antibody
    • Protein G4.5 antibody
    • Tafazzin antibody
    • TAZ antibody
    • TAZ protein antibody
    • TAZ_HUMAN antibody
    • Taz1 antibody
    see all

References

ab224655 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224655.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up