Anti-tag-72 antibody [B72.3 + CC49] (ab199002)

Overview

  • Product name

    Anti-tag-72 antibody [B72.3 + CC49]
  • Description

    Mouse monoclonal [B72.3 + CC49] to tag-72
  • Host species

    Mouse
  • Specificity

    Recognizes an oncofetal antigen of 220kDa, identified as a tumor-associated glycoprotein (TAG-72) with properties of a mucin. This MAb defines the mucin-carried sialylated-Tn epitope. TAG-72 is usually expressed by adenocarcinomas, but is negative in mesotheliomas.
  • Tested applications

    Suitable for: WB, IP, IHC-P, Flow Cyt, ICC/IF, IHC-Frmore details
  • Species reactivity

    Reacts with: Rat, Cow, Dog, Human
    Predicted to work with: Caenorhabditis elegans
  • Immunogen

    Recombinant full length protein corresponding to Caenorhabditis elegans tag-72 aa 1-380.
    Sequence:

    MSSSEVASHYNKVLQVGIEGRKESRIFFMRNMNNWVKSQLINDAKQRVND NGVNNPRVLDLACGKGGDLKKWDIAGAKDVVMADVADVSIQQAEERYKQM FGYKKNNIFTVQFIVADCTKENLEDRIENKDPFDLVSCQFALHYSFVDEA SARIFLKNAVGMLKPGGVFIGTLPDADRIVWSMRNGENGQFANEVCKITY ENVEELAEGKVPLFGAKFHFSLDEQVNCPEFLAYFPLVKHLLEELDMELL FVHNFAEAINKWLEPGRRLLESMTGLETYPNEKLSGKSDDEYLEAKAKLD AFPEDERIKTMGTLSKSEWEAICMYLVFGFRKKKSEAEKTEEEPATTKPV AESESEQKEVTESEEKEDQEDCEHQEAQTN


    Database link: Q9XVS1

  • Positive control

    • Jurkat cells, Breast or lung carcinoma.
  • General notes

    Please note that this antibody is an oligoclonal antibody. It is a cocktail of monoclonal antibodies that have been carefully selected. Oligoclonal antibodies have not only the specificity and batch-to-batch consistency of a monoclonal antibody, but also have the advantage of the sensitivity of a polyclonal antibody due to their ability to recognize multiple epitopes on an antigen. 

    Both antibodies (B72.3 + CC49) are mouse IgG1 kappa.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 99% PBS, 0.05% BSA
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    B72.3 + CC49
  • Isotype

    IgG1
  • Light chain type

    kappa

Applications

Our Abpromise guarantee covers the use of ab199002 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 220 kDa.
IP Use at 2-4 µg/mg of lysate.
IHC-P Use a concentration of 0.5 - 1 µg/ml.
Flow Cyt Use 0.5-1µg for 106 cells.
ICC/IF Use a concentration of 1 - 2 µg/ml.
IHC-Fr Use a concentration of 0.5 - 1 µg/ml.

Target

  • Alternative names

    • CA 72.4 antibody
    • Tumor associated glycoprotein 72 antibody

Images

  • Immunohistochemical analysis of Formalin-fixed, paraffin-embedded Human colon cancer tissue labeling TAG72 with ab199002 at 1µg/mL.

References

ab199002 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199002.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up