Anti-TAGLN/Transgelin antibody (ab137453)
Key features and details
- Rabbit polyclonal to TAGLN/Transgelin
- Suitable for: ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TAGLN/Transgelin antibody
See all TAGLN/Transgelin primary antibodies -
Description
Rabbit polyclonal to TAGLN/Transgelin -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Chicken, Cow -
Immunogen
Recombinant fragment corresponding to Human TAGLN/Transgelin aa 1-201.
Sequence:MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRL GFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKA AEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPN WFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQII S
Database link: Q01995 -
Positive control
- HeLa cells; HepG2 whole cell lysate
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.00
Preservative: 0.025% Proclin 300
Constituents: 79% PBS, 20% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab137453 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | (1) |
1/100 - 1/1000.
|
WB | (2) |
1/500 - 1/3000. Predicted molecular weight: 23 kDa.
|
Notes |
---|
ICC/IF
1/100 - 1/1000. |
WB
1/500 - 1/3000. Predicted molecular weight: 23 kDa. |
Target
-
Function
Actin cross-linking/gelling protein (By similarity). Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence. -
Sequence similarities
Belongs to the calponin family.
Contains 1 calponin-like repeat.
Contains 1 CH (calponin-homology) domain. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 6876 Human
- Entrez Gene: 21345 Mouse
- Entrez Gene: 25123 Rat
- SwissProt: Q01995 Human
- SwissProt: P37804 Mouse
- SwissProt: P31232 Rat
- Unigene: 410977 Human
- Unigene: 283283 Mouse
see all -
Alternative names
- 22 kDa actin-binding protein antibody
- Protein WS3-10 antibody
- SM22 antibody
see all
Images
-
Anti-TAGLN/Transgelin antibody (ab137453) at 1/1000 dilution + HepG2 whole cell lysate at 30 µg
Predicted band size: 23 kDa
12% SDS PAGE -
Immunofluorescence analysis of paraformaldehyde fixed HeLa cells labelling SM22 alpha with ab137453 at a 1/200 dilution. The image in the lower panel is merged with a DNA probe.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab137453 has been referenced in 2 publications.
- Zheng X et al. The phenotype of vascular smooth muscle cells co-cultured with endothelial cells is modulated by PDGFR-ß/IQGAP1 signaling in LPS-induced intravascular injury. Int J Med Sci 16:1149-1156 (2019). PubMed: 31523178
- Klose R et al. Loss of the serine protease HTRA1 impairs smooth muscle cells maturation. Sci Rep 9:18224 (2019). PubMed: 31796853