Anti-TAGLN/Transgelin antibody (ab233158)

Overview

  • Product name

    Anti-TAGLN/Transgelin antibody
    See all TAGLN/Transgelin primary antibodies
  • Description

    Rabbit polyclonal to TAGLN/Transgelin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human TAGLN/Transgelin aa 1-201. Expressed in E. coli. N-terminal tags.
    Sequence:

    MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRL GFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKA AEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPN WFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQII S


    Database link: Q01995

  • Positive control

    • IHC-P: Human stomach cancer, colorectal cancer, kidney, stomach, prostate and prostate cancer tissue. WB: Recombinant human TAGLN/Transgelin protein. Human lung tissue lysate. Pig uterus and intestine tissue lysate.
  • General notes

     This product was previously labelled as TAGLN

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab233158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    Actin cross-linking/gelling protein (By similarity). Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • 22 kDa actin-binding protein antibody
    • Protein WS3-10 antibody
    • SM22 antibody
    • SM22-alpha antibody
    • Smooth muscle protein 22-alpha antibody
    • Transgelin antibody
    • WS3-10 antibody
    see all

Images

  • All lanes : Anti-TAGLN/Transgelin antibody (ab233158) at 1 µg/ml

    Lane 1 : Human lung tissue lysate
    Lane 2 : Pig uterus tissue lysate
    Lane 3 : Pig intestine tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human stomach tissue stained for TAGLN/Transgelin with ab233158 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for TAGLN/Transgelin with ab233158 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for TAGLN/Transgelin with ab233158 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for TAGLN/Transgelin with ab233158 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for TAGLN/Transgelin with ab233158 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for TAGLN/Transgelin with ab233158 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Anti-TAGLN/Transgelin antibody (ab233158) at 1 µg/ml + Recombinant human TAGLN/Transgelin protein

References

ab233158 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up