Overview

  • Product name

  • Description

    Rabbit polyclonal to Tal1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Tal1 aa 134-190.
    Sequence:

    RALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPH TKVVRRI


    Database link: P17542

  • Positive control

    • ICC/IF: Caco-2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. Serves as a positive regulator of erythroid differentiation.
  • Tissue specificity

    Leukemic stem cell.
  • Involvement in disease

    Note=A chromosomal aberration involving TAL1 may be a cause of some T-cell acute lymphoblastic leukemias (T-ALL). Translocation t(1;14)(p32;q11) with T-cell receptor alpha chain (TCRA) genes.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Domain

    The helix-loop-helix domain is necessary and sufficient for the interaction with DRG1.
  • Post-translational
    modifications

    Phosphorylated on serine residues. Phosphorylation of Ser-122 is strongly stimulated by hypoxia.
    Ubiquitinated; subsequent to hypoxia-dependent phosphorylation of Ser-122, ubiquitination targets the protein for rapid degradation via the ubiquitin system. This process may be characteristic for microvascular endothelial cells, since it could not be observed in large vessel endothelial cells.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bHLHa17 antibody
    • Class A basic helix-loop-helix protein 17 antibody
    • OTTHUMP00000009563 antibody
    • OTTHUMP00000009564 antibody
    • SCL antibody
    • STEM CELL LEUKEMIA HEMATOPOIETIC TRANSCRIPTION FACTOR antibody
    • Stem cell protein antibody
    • T cell acute lymphocytic leukemia 1 antibody
    • T cell acute lymphocytic leukemia 1 protein antibody
    • T cell acute lymphocytic leukemia 1 protein antibody
    • T cell leukemia/lymphoma 5 protein antibody
    • T-cell acute lymphocytic leukemia protein 1 antibody
    • T-cell leukemia/lymphoma protein 5 antibody
    • Tal 1 antibody
    • Tal 1 product antibody
    • TAL 1 protein antibody
    • TAL bHLH transcription factor 1 erythroid differentiation factor antibody
    • TAL-1 antibody
    • tal1 antibody
    • TAL1_HUMAN antibody
    • TCL 5 antibody
    • TCL5 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized Caco-2 (human colorectal adenocarcinoma cell line) cells stained for Tal1 (green) using ab222123 at 4 µg/ml in ICC/IF.

References

ab222123 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up