Overview

  • Product name

    Anti-Tal1 antibody [OTI6A2]
    See all Tal1 primary antibodies
  • Description

    Mouse monoclonal [OTI6A2] to Tal1
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Rat, Dog, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human Tal1 aa 1-331. Produced in HEK-293T cells (NP_003180).
    Sequence:

    MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPP VIELGARGGPGGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPA PAPAPASVTAELPGDGRMVQLSPPALAAPAAPGRALLYSLSQPLASLGSG FFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHTKVVRRIFTNSRERWRQ QNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEG TQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAAS PDSYTEEPAPKHTARSLHPAMLPAADGAGPR


    Database link: P17542

  • Positive control

    • WB: pCMV6-ENTRY Tal1 cDNA transfected HEK-293T cell lysate; MDCK and PC-12 cell lysates. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY Tal1 cDNA. Flow: HEK-293T cells.
  • General notes

    Clone OTI6A2 (formerly 6A2).

Properties

Applications

Our Abpromise guarantee covers the use of ab236520 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/100.
ICC/IF 1/100.
WB 1/2000. Predicted molecular weight: 34 kDa.

Target

  • Function

    Implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. Serves as a positive regulator of erythroid differentiation.
  • Tissue specificity

    Leukemic stem cell.
  • Involvement in disease

    Note=A chromosomal aberration involving TAL1 may be a cause of some T-cell acute lymphoblastic leukemias (T-ALL). Translocation t(1;14)(p32;q11) with T-cell receptor alpha chain (TCRA) genes.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Domain

    The helix-loop-helix domain is necessary and sufficient for the interaction with DRG1.
  • Post-translational
    modifications

    Phosphorylated on serine residues. Phosphorylation of Ser-122 is strongly stimulated by hypoxia.
    Ubiquitinated; subsequent to hypoxia-dependent phosphorylation of Ser-122, ubiquitination targets the protein for rapid degradation via the ubiquitin system. This process may be characteristic for microvascular endothelial cells, since it could not be observed in large vessel endothelial cells.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bHLHa17 antibody
    • Class A basic helix-loop-helix protein 17 antibody
    • OTTHUMP00000009563 antibody
    • OTTHUMP00000009564 antibody
    • SCL antibody
    • STEM CELL LEUKEMIA HEMATOPOIETIC TRANSCRIPTION FACTOR antibody
    • Stem cell protein antibody
    • T cell acute lymphocytic leukemia 1 antibody
    • T cell acute lymphocytic leukemia 1 protein antibody
    • T cell acute lymphocytic leukemia 1 protein antibody
    • T cell leukemia/lymphoma 5 protein antibody
    • T-cell acute lymphocytic leukemia protein 1 antibody
    • T-cell leukemia/lymphoma protein 5 antibody
    • Tal 1 antibody
    • Tal 1 product antibody
    • TAL 1 protein antibody
    • TAL bHLH transcription factor 1 erythroid differentiation factor antibody
    • TAL-1 antibody
    • tal1 antibody
    • TAL1_HUMAN antibody
    • TCL 5 antibody
    • TCL5 antibody
    see all

Images

  • All lanes : Anti-Tal1 antibody [OTI6A2] (ab236520) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY Tal1 cDNA transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 34 kDa

  • All lanes : Anti-Tal1 antibody [OTI6A2] (ab236520) at 1/200 dilution

    Lane 1 : MDCK (Canine kidney cell line) cell lysate
    Lane 2 : PC-12 (Rat adrenal gland pheochromocytoma cell line) cell lysate

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 34 kDa

  • COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY Tal1 cDNA stained for Tal1 (green) using ab236520 at 1/100 dilution in ICC/IF.

  • Flow cytometric analysis of HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell line labeling Tal1 with ab236520 at 1/100 dilution (red) compared to a non-specific negative control antibody (blue).

References

ab236520 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236520.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up