Overview

  • Product name

    Anti-Talin 1 and 2 antibody
    See all Talin 1 and 2 primary antibodies
  • Description

    Rabbit polyclonal to Talin 1 and 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Talin 1 aa 1610-1660 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    AGGLIQTARALAVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQL E


    Database link: Q9Y490

  • Positive control

    • Rat kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab214187 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Talin, a multifunctional constituent of cell-substratum attachment sites, is a high molecular weight protein (225-235 kDa) found in variety of tissues and cell types. It is localized at a subset of adherens junctions, specialized cell-cell and cell-matrix associations that are characterized by the presence of filamentous actin at the cytoplasmic face of the junctional complex. In cultured cells, talin is absent from cell-cell junctions and found predominantly at adhesion plaques and in fibrillar streaks underlying cell surface fibronectin. Talin interacts with at least two other proteins that are localized at adhesion plaques, vinculin and integrin. Talin and vinculin have been shown to interact with each other and both have been proposed to be involved in generating the transmembrane connection, between the extracellular matrix and the cytoskeleton, that occurs at adhesion plaques. At physiological ionic strength, talin is an elongate, flexible, monomeric protein with the ability to self-associate into dimers at higher protein concentrations. Talin 2 is related to talin 1. This protein has a different pattern of expression compared to talin 1 but, like talin 1, is thought to associate with unique transmembrane receptors to form novel linkages between extracellular matrices and the actin cytoskeleton.
  • Cellular localization

    Cell projection, ruffle membrane (talin 1), Focal adhesion plaques and synapses (talin 2)
  • Database links

  • Alternative names

    • talin 1 antibody
    • talin 2 antibody
    • talin antibody
    • talin1 antibody
    • talin2 antibody
    • TLN antibody
    • TLN1 antibody
    • TLN2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat kidney tissue labeling Talin 1 and 2 with ab214187 at 1/100 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab214187 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214187.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up