Overview

  • Product name

  • Description

    Rabbit polyclonal to Talin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Talin 1 aa 975-1181. (Expressed in E.coli).
    Sequence:

    AQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCA KNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEIKAAAREG KLKPLPGETMEKCTQDLGNSTKAVSSAIAKLLGEIAQGNENYAGIAARDV AGGLRSLAQAARGVAALTTDPAVQAIVLDTASDALDKASSLIEEAKKASG HPGDPES


    Database link: G3V852

  • Positive control

    • IHC-P: Rat stomach and pancreas tissues. WB: HepG2 cell lysate, Rat serum; Recombinant rat Talin 1 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231653 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231653 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 270 kDa.

Target

  • Function

    Probably involved in connections of major cytoskeletal structures to the plasma membrane. High molecular weight cytoskeletal protein concentrated at regions of cell-substratum contact and, in lymphocytes, at cell-cell contacts.
  • Sequence similarities

    Contains 1 FERM domain.
    Contains 1 I/LWEQ domain.
  • Cellular localization

    Cell projection, ruffle membrane. Cytoplasm, cytoskeleton. Cell surface. Cell junction, focal adhesion. Colocalizes with LAYN at the membrane ruffles. Localized preferentially in focal adhesions than fibrillar adhesions (By similarity).
  • Information by UniProt
  • Database links

  • Alternative names

    • ILWEQ antibody
    • Talin 1 antibody
    • Talin antibody
    • Talin-1 antibody
    • TLN 1 antibody
    • TLN antibody
    • Tln1 antibody
    • TLN1_HUMAN antibody
    see all

Images

  • Paraffin-embedded rat stomach tissue stained for Talin 1 using ab231653 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat pancreas tissue stained for Talin 1 using ab231653 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Talin 1 antibody (ab231653) at 3 µg/ml + Recombinant rat Talin 1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 270 kDa

  • All lanes : Anti-Talin 1 antibody (ab231653) at 3 µg/ml

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : Rat serum

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 270 kDa

  • Anti-Talin 1 antibody (ab231653) at 5 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 270 kDa

  • Anti-Talin 1 antibody (ab231653) at 5 µg/ml + Rat serum

    Predicted band size: 270 kDa

References

ab231653 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231653.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up