Overview

  • Product name

    Anti-TALLA-1 antibody [CL0262]
    See all TALLA-1 primary antibodies
  • Description

    Mouse monoclonal [CL0262] to TALLA-1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human TALLA-1 aa 119-211.
    Sequence:

    TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEH GIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET


    Database link: P41732

  • Epitope

    Binds to an epitope located within the peptide sequence NDERSRAVDHVQRSL as determined by overlapping synthetic peptides.
  • Positive control

    • Human cerebral cortex, cerebellum and pancreas tissues; TALLA-1 over-expression HEK293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab211870 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 28 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • A15 antibody
    • CCG B7 antibody
    • CD231 antibody
    • CD231 antigen antibody
    • Cell surface glycoprotein A15 antibody
    • DXS1692E antibody
    • Membrane component chromosome X surface marker 1 antibody
    • Membrane component X chromosome surface marker 1 antibody
    • MRX58 antibody
    • MXS1 antibody
    • T cell acute lymphoblastic leukemia associated antigen 1 antibody
    • T-cell acute lymphoblastic leukemia-associated antigen 1 antibody
    • TALLA 1 antibody
    • TALLA antibody
    • TALLA-1 antibody
    • TALLA1 antibody
    • Tetraspanin 7 antibody
    • Tetraspanin-7 antibody
    • TM4SF2 antibody
    • TM4SF2b antibody
    • Transmembrane 4 superfamily 2b antibody
    • Transmembrane 4 superfamily member 2 antibody
    • Transmembrane protein A15 antibody
    • TSN7_HUMAN antibody
    • Tspan 7 antibody
    • Tspan-7 antibody
    • TSPAN7 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labeling TALLA-1 with ab211870 at 1/500 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human cerebellum tissue labeling TALLA-1 with ab211870 at 1/500 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue labeling TALLA-1 with ab211870 at 1/500 dilution.

  • All lanes : Anti-TALLA-1 antibody [CL0262] (ab211870) at 1/500 dilution

    Lane 1 : Negative control (vector only transfected HEK293T lysate)
    Lane 2 : TALLA-1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)

    Predicted band size: 28 kDa

References

ab211870 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211870.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up