Anti-TAM41 antibody (ab230359)
Key features and details
- Rabbit polyclonal to TAM41
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-TAM41 antibody
See all TAM41 primary antibodies -
Description
Rabbit polyclonal to TAM41 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Cow -
Immunogen
Recombinant fragment corresponding to Human TAM41 aa 161-452.
Sequence:VTAAFLMLPESFSEEDLFIEIAGLSYSGDFRMVVGEDKTKVLNIVKPNIA HFRELYGSILQENPQVVYKSQQGWLEIDKSPEGQFTQLMTLPKTLQQQIN HIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLSAIVRPSSIRQSTKGIF TAGKSFGNPCVTYLLTEWLPHSWLQCKALYLLGACEMLSFDGHKLGYCSK VQTGITAAEPGGRTMSDHWQCCWKLYCPSEFSETLPVCRVFPSYCFIYQS YRCIGLQKQQHLCSPSSSPSLRQLLPSVLVGYFCCYCHFSKW
Database link: Q96BW9 -
Positive control
- WB: Mouse brain lysate. IHC-P: Human kidney and glioma cancer tissues. ICC/IF: PC-3 cells.
-
General notes
Previously labelled as C3ORF31.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab230359 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | 1/50 - 1/200. | |
IHC-P | 1/20 - 1/200. | |
WB | 1/1000 - 1/5000. Detects a band of approximately 51 kDa (predicted molecular weight: 51 kDa). |
Target
-
Function
Catalyzes the formation of CDP-diacylglycerol (CDP-DAG) from phosphatidic acid (PA) in the mitochondrial inner membrane. Required for the biosynthesis of the dimeric phospholipid cardiolipin, which stabilizes supercomplexes of the mitochondrial respiratory chain in the mitochondrial inner membrane. -
Pathway
Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 3/3. -
Sequence similarities
Belongs to the TAM41 family. -
Cellular localization
Mitochondrion inner membrane. - Information by UniProt
-
Database links
- Entrez Gene: 514330 Cow
- Entrez Gene: 132001 Human
- Omim: 614948 Human
- SwissProt: Q32L81 Cow
- SwissProt: Q96BW9 Human
- SwissProt: Q3TUH1 Mouse
- Unigene: 475472 Human
- Unigene: 24937 Mouse
-
Alternative names
- C3ORF31 antibody
- CDP-DAG synthase antibody
- CDP-diacylglycerol synthase antibody
see all
Images
-
Anti-TAM41 antibody (ab230359) at 1/1000 dilution + Mouse brain lysate
Secondary
Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 51 kDa
Observed band size: 51 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TAM41 antibody (ab230359)
Paraffin-embedded human kidney tissue stained for TAM41 using ab230359 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TAM41 antibody (ab230359)
Paraffin-embedded human glioma cancer tissue stained for TAM41 using ab230359 at 1/100 dilution in immunohistochemical analysis.
-
PC-3 (human prostate adenocarcinoma cell line) cells stained for TAM41 (green) using ab230359 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab230359 has not yet been referenced specifically in any publications.