Overview

  • Product name

  • Description

    Rabbit polyclonal to TANK/TRAF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human TANK/TRAF2 aa 131-369. (Expressed in E.coli).
    Sequence:

    LLHERGNIEKTFWDLKEEFHKICMLAKAQKDHLSKLNIPDTATETQCSVP IQCTDKTDKQEALFKPQAKDDINRGAPSITSVTPRGLCRDEEDTSFESLS KFNVKFPPMDNDSTFLHSTPERPGILSPATSEAVCQEKFNMEFRDNPGNF VKTEETLFEIQGIDPIASAIQNLKTTDKTKPSNLVNTCIRTTLDRAACLP PGDHNALYVNSFPLLDPSDAPFPSLDSPGKAIRGPQQPI


    Database link: Q92844

  • Positive control

    • IHC-P: Human kidney tissue. WB: Pig colon lysate; Recombinant human TANK/TRAF2 protein.
  • General notes

     This product was previously labelled as TANK

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 48 kDa.

Target

  • Function

    Acts as a regulator of TRAF function by maintaining them in a latent state. Overexpression inhibits TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. May be involved in I-kappa-B-kinase (IKK) regulation; may function as an adapter for kinases such as TBK1 or IKBKE that can modulate IKK activity.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 C2H2-type zinc finger.
  • Post-translational
    modifications

    Phosphorylated by IKBKE.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • I TRAF antibody
    • I-TRAF antibody
    • ITRAF antibody
    • Tank antibody
    • TANK_HUMAN antibody
    • TRAF family member associated NF KAPPA B activator antibody
    • TRAF family member associated NFKB activator antibody
    • TRAF family member-associated NF-kappa-B activator antibody
    • TRAF interacting protein antibody
    • TRAF interacting protein TANK isoform a antibody
    • TRAF interacting protein TANK isoform b antibody
    • TRAF-interacting protein antibody
    • TRAF2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for TANK/TRAF2 using ab233406 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-TANK/TRAF2 antibody (ab233406) at 2 µg/ml + Recombinant human TANK/TRAF2 protein

    Predicted band size: 48 kDa

  • Anti-TANK/TRAF2 antibody (ab233406) at 2 µg/ml + Pig colon lysate

    Predicted band size: 48 kDa

References

ab233406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up