Overview

  • Product name

    Anti-Tankyrase 2/TNKS2 antibody
    See all Tankyrase 2/TNKS2 primary antibodies
  • Description

    Rabbit polyclonal to Tankyrase 2/TNKS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide corresponding to Human Tankyrase 2/TNKS2 aa 1-44 (N terminal). Carrier-protein conjugated synthetic peptide.
    Sequence:

    MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLV


    Database link: Q9H2K2

  • Positive control

    • ICC/IF: HeLa cells. WB: Jurkat, Raji, NCI-H929, A431, HeLa and HepG2 whole cell lysates.
  • General notes

    Previously labelled as Tankyrase 2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab155545 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 127 kDa.
ICC/IF 1/100 - 1/1000.

Target

  • Function

    Poly-ADP-ribosyltransferase involved in various processes such as Wnt signaling pathway, telomere length and vesicle trafficking. Acts as an activator of the Wnt signaling pathway by mediating poly-ADP-ribosylation of AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex: poly-ADP-ribosylated target proteins are recognized by RNF146, which mediates their ubiquitination and subsequent degradation. Also mediates poly-ADP-ribosylation of BLZF1 and CASC3, followed by recruitment of RNF146 and subsequent ubiquitination. Mediates poly-ADP-ribosylation of TERF1, thereby contributing to the regulation of telomere length. May also regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles.
  • Tissue specificity

    Highly expressed in placenta, skeletal muscle, liver, brain, kidney, heart, thymus, spinal cord, lung, peripheral blood leukocytes, pancreas, lymph nodes, spleen, prostate, testis, ovary, small intestine, colon, mammary gland, breast and breast carcinoma, and in common-type meningioma. Highly expressed in fetal liver, heart and brain.
  • Sequence similarities

    Contains 15 ANK repeats.
    Contains 1 PARP catalytic domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Post-translational
    modifications

    Ubiquitinated at 'Lys-48' and 'Lys-63' by RNF146 when auto-poly-ADP-ribosylated; this leads to degradation.
    ADP-ribosylated (-auto). Poly-ADP-ribosylated protein is recognized by RNF146, followed by ubiquitination.
    The crystallographic evidence suggests that the 3-hydroxyhistidine may be the (3S) stereoisomer.
  • Cellular localization

    Cytoplasm. Golgi apparatus membrane. Nucleus. Chromosome > telomere. Associated with the Golgi and with juxtanuclear SLC2A4/GLUT4-vesicles. Also found around the pericentriolar matrix of mitotic centromeres. During interphase, a small fraction of TNKS2 is found in the nucleus, associated with TRF1.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADP-ribosyltransferase diphtheria toxin-like 6 antibody
    • ARTD6 antibody
    • PARP 5b antibody
    • PARP 5c antibody
    • PARP-5b antibody
    • PARP-5c antibody
    • PARP5B antibody
    • PARP5C antibody
    • pART6 antibody
    • Poly [ADP ribose] polymerase 5B antibody
    • Poly [ADP-ribose] polymerase 5B antibody
    • TANK2 antibody
    • Tankyrase 2 antibody
    • Tankyrase II antibody
    • Tankyrase like protein antibody
    • Tankyrase related protein antibody
    • Tankyrase TRF1 interacting ankyrin related ADP ribose polymerase 2 antibody
    • Tankyrase-2 antibody
    • Tankyrase-like protein antibody
    • Tankyrase-related protein antibody
    • TNKL antibody
    • TNKS 2 antibody
    • TNKS-2 antibody
    • TNKS2 antibody
    • TNKS2_HUMAN antibody
    • TRF1 Interacting Ankyrin Related ADP ribose polymerase 2 antibody
    • TRF1-interacting ankyrin-related ADP-ribose polymerase 2 antibody
    see all

Images

  • Confocal immunofluorescence analysis of paraformaldehyde-fixed HeLa, labeling Tankyrase 2/TNKS2 (green) with ab155545 at 1/500 dilution. alpha-Tubulin is stained red.

  • All lanes : Anti-Tankyrase 2/TNKS2 antibody (ab155545) at 1/500 dilution

    Lane 1 : Jurkat whole cell extracts
    Lane 2 : Raji whole cell extracts
    Lane 3 : NCI-H929 whole cell extracts

    Lysates/proteins at 30 µg per lane.

    Secondary
    All lanes : anti-rabbit IgG antibody at 1/10000 dilution

    Predicted band size: 127 kDa



    10% gel. Running conditions: 80V, 15min; 140V, 40 min. Transfer conditions: Semi-dry, 18 V, 60 min (Nitrocellulose membrane). Blocking: 5% non-fat milk in TBST, RT, 60 min. Primary antibody incubation at 4°C overnight. Washing: 5 ml TBST, 4 x 5 min. ECL exposure. 

  • All lanes : Anti-Tankyrase 2/TNKS2 antibody (ab155545) at 1/1000 dilution

    Lane 1 : A431 whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : HepG2 whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 127 kDa



    7.5% SDS PAGE

References

ab155545 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155545.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up