Anti-Tankyrase 2/TNKS2 antibody (ab155545)
Key features and details
- Rabbit polyclonal to Tankyrase 2/TNKS2
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Tankyrase 2/TNKS2 antibody -
Description
Rabbit polyclonal to Tankyrase 2/TNKS2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Synthetic peptide corresponding to Human Tankyrase 2/TNKS2 aa 1-44 (N terminal). Carrier-protein conjugated synthetic peptide.
Sequence:MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLV
Database link: Q9H2K2 -
Positive control
- ICC/IF: HeLa cells. WB: Jurkat, Raji, NCI-H929, A431, HeLa and HepG2 whole cell lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 10% Glycerol (glycerin, glycerine), 1.21% Tris, 0.75% Glycine -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab155545 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/3000. Predicted molecular weight: 127 kDa.
|
|
ICC/IF |
1/100 - 1/1000.
|
Notes |
---|
WB
1/500 - 1/3000. Predicted molecular weight: 127 kDa. |
ICC/IF
1/100 - 1/1000. |
Target
-
Function
Poly-ADP-ribosyltransferase involved in various processes such as Wnt signaling pathway, telomere length and vesicle trafficking. Acts as an activator of the Wnt signaling pathway by mediating poly-ADP-ribosylation of AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex: poly-ADP-ribosylated target proteins are recognized by RNF146, which mediates their ubiquitination and subsequent degradation. Also mediates poly-ADP-ribosylation of BLZF1 and CASC3, followed by recruitment of RNF146 and subsequent ubiquitination. Mediates poly-ADP-ribosylation of TERF1, thereby contributing to the regulation of telomere length. May also regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. -
Tissue specificity
Highly expressed in placenta, skeletal muscle, liver, brain, kidney, heart, thymus, spinal cord, lung, peripheral blood leukocytes, pancreas, lymph nodes, spleen, prostate, testis, ovary, small intestine, colon, mammary gland, breast and breast carcinoma, and in common-type meningioma. Highly expressed in fetal liver, heart and brain. -
Sequence similarities
Contains 15 ANK repeats.
Contains 1 PARP catalytic domain.
Contains 1 SAM (sterile alpha motif) domain. -
Post-translational
modificationsUbiquitinated at 'Lys-48' and 'Lys-63' by RNF146 when auto-poly-ADP-ribosylated; this leads to degradation.
ADP-ribosylated (-auto). Poly-ADP-ribosylated protein is recognized by RNF146, followed by ubiquitination.
The crystallographic evidence suggests that the 3-hydroxyhistidine may be the (3S) stereoisomer. -
Cellular localization
Cytoplasm. Golgi apparatus membrane. Nucleus. Chromosome > telomere. Associated with the Golgi and with juxtanuclear SLC2A4/GLUT4-vesicles. Also found around the pericentriolar matrix of mitotic centromeres. During interphase, a small fraction of TNKS2 is found in the nucleus, associated with TRF1. - Information by UniProt
-
Database links
- Entrez Gene: 80351 Human
- Entrez Gene: 74493 Mouse
- Omim: 607128 Human
- SwissProt: Q9H2K2 Human
- SwissProt: Q3UES3 Mouse
- Unigene: 329327 Human
- Unigene: 249310 Mouse
-
Alternative names
- ADP-ribosyltransferase diphtheria toxin-like 6 antibody
- ARTD6 antibody
- PARP 5b antibody
see all
Images
-
Confocal immunofluorescence analysis of paraformaldehyde-fixed HeLa, labeling Tankyrase 2/TNKS2 (green) with ab155545 at 1/500 dilution. alpha-Tubulin is stained red.
-
All lanes : Anti-Tankyrase 2/TNKS2 antibody (ab155545) at 1/500 dilution
Lane 1 : Jurkat whole cell extracts
Lane 2 : Raji whole cell extracts
Lane 3 : NCI-H929 whole cell extracts
Lysates/proteins at 30 µg per lane.
Secondary
All lanes : anti-rabbit IgG antibody at 1/10000 dilution
Predicted band size: 127 kDa10% gel. Running conditions: 80V, 15min; 140V, 40 min. Transfer conditions: Semi-dry, 18 V, 60 min (Nitrocellulose membrane). Blocking: 5% non-fat milk in TBST, RT, 60 min. Primary antibody incubation at 4°C overnight. Washing: 5 ml TBST, 4 x 5 min. ECL exposure.
-
All lanes : Anti-Tankyrase 2/TNKS2 antibody (ab155545) at 1/1000 dilution
Lane 1 : A431 whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : HepG2 whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 127 kDa
7.5% SDS PAGE
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab155545 has been referenced in 2 publications.
- Wu M et al. Down-regulation of hsa_circ_0045474 induces macrophage autophagy in tuberculosis via miR-582-5p/TNKS2 axis. Innate Immun 28:11-18 (2022). PubMed: 34861798
- Yoon S et al. Usp9X Controls Ankyrin-Repeat Domain Protein Homeostasis during Dendritic Spine Development. Neuron 105:506-521.e7 (2020). PubMed: 31813652