Anti-Tankyrase binding protein 1 antibody (ab197051)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Tankyrase binding protein 1 antibody
See all Tankyrase binding protein 1 primary antibodies -
Description
Rabbit polyclonal to Tankyrase binding protein 1 -
Host species
Rabbit -
Specificity
ab197051 detects endogenous levels of total Tankyrase binding protein 1 protein. -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide within Human Tankyrase binding protein 1 aa 1601-1650. The exact sequence is proprietary.
Sequence:DSDAHLFQDSTEPRASRVPSSDEEVVEEPQSRRTRMSLGTKGLKVNLFPG
Database link: Q9C0C2 -
Positive control
- 293 cell extract; Human kidney tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS, 0.87% Sodium chloride -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab197051 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | 1/500 - 1/1000. Predicted molecular weight: 182 kDa. |
Target
-
Tissue specificity
Detected in testis, ovary, lung, skeletal muscle, heart, prostate and pancreas, and at very low levels in brain and peripheral blood leukocytes. -
Post-translational
modificationsADP-ribosylated by TNKS1 (in vitro).
Phosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Nucleus. Cytoplasm > cytoskeleton. Chromosome. Colocalizes with chromosomes during mitosis, and in the cytoplasm with cortical actin. - Information by UniProt
-
Database links
- Entrez Gene: 85456 Human
- Entrez Gene: 228140 Mouse
- Omim: 607104 Human
- SwissProt: Q9C0C2 Human
- SwissProt: P58871 Mouse
- Unigene: 530730 Human
- Unigene: 23606 Mouse
-
Alternative names
- 182 kDa tankyrase 1 binding protein antibody
- 182 kDa tankyrase-1-binding protein antibody
- FLJ45975 antibody
see all
Images
-
All lanes : Anti-Tankyrase binding protein 1 antibody (ab197051) at 1/500 dilution
Lane 1 : 293 cell extract
Lane 2 : 293 cell extract with synthetic peptide
Predicted band size: 182 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Tankyrase binding protein 1 antibody (ab197051)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded human kidney tissue labeling Tankyrase binding protein 1 with ab197051 at 10 µg/ml.
Datasheets and documents
References
ab197051 has not yet been referenced specifically in any publications.