Anti-Tankyrase binding protein 1 antibody (ab197051)

Submit a review Submit a question

Key features and details

  • Rabbit polyclonal to Tankyrase binding protein 1
  • Suitable for: IHC-P, WB
  • Reacts with: Mouse, Human
  • Isotype: IgG

Overview

  • Product name

    Anti-Tankyrase binding protein 1 antibody
    See all Tankyrase binding protein 1 primary antibodies

  • Description

    Rabbit polyclonal to Tankyrase binding protein 1

  • Host species

    Rabbit

  • Specificity

    ab197051 detects endogenous levels of total Tankyrase binding protein 1 protein.

  • Tested applications

    Suitable for: IHC-P, WBmore details

  • Species reactivity

    Reacts with: Mouse, Human

  • Immunogen

    Synthetic peptide within Human Tankyrase binding protein 1 aa 1601-1650. The exact sequence is proprietary.
    Sequence:

    DSDAHLFQDSTEPRASRVPSSDEEVVEEPQSRRTRMSLGTKGLKVNLFPG


    Database link: Q9C0C2

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • 293 cell extract; Human kidney tissue.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS, 0.87% Sodium chloride
  • Concentration information loading...

  • Purity

    Immunogen affinity purified

  • Clonality

    Polyclonal

  • Isotype

    IgG

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 182 kDa.

Target

  • Tissue specificity

    Detected in testis, ovary, lung, skeletal muscle, heart, prostate and pancreas, and at very low levels in brain and peripheral blood leukocytes.

  • Post-translational
    modifications

    ADP-ribosylated by TNKS1 (in vitro).
    Phosphorylated upon DNA damage, probably by ATM or ATR.

  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton. Chromosome. Colocalizes with chromosomes during mitosis, and in the cytoplasm with cortical actin.
  • Information by UniProt

  • Database links

    • Alternative names

      • 182 kDa tankyrase 1 binding protein antibody
      • 182 kDa tankyrase-1-binding protein antibody
      • FLJ45975 antibody
      • KIAA1741 antibody
      • TAB182 antibody
      • Tankyrase 1 binding protein 1 182 kDa antibody
      • Tankyrase 1 binding protein 1 antibody
      • Tankyrase 1 binding protein of 182 kDa antibody
      • TB182_HUMAN antibody
      • Tnks1bp1 antibody
      see all

    Images

    • Western blot - Anti-Tankyrase binding protein 1 antibody (ab197051)
      Western blot - Anti-Tankyrase binding protein 1 antibody (ab197051)
      All lanes : Anti-Tankyrase binding protein 1 antibody (ab197051) at 1/500 dilution

      Lane 1 : 293 cell extract
      Lane 2 : 293 cell extract with synthetic peptide

      Predicted band size: 182 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Tankyrase binding protein 1 antibody (ab197051)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Tankyrase binding protein 1 antibody (ab197051)

      Immunohistochemical analysis of formalin-fixed, paraffin-embedded human kidney tissue labeling Tankyrase binding protein 1 with ab197051 at 10 µg/ml.

    References (0)

    Publishing research using ab197051? Please let us know so that we can cite the reference in this datasheet.

    ab197051 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab197051.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com