Overview

  • Product name

    Anti-Tankyrase binding protein 1 antibody
    See all Tankyrase binding protein 1 primary antibodies
  • Description

    Rabbit polyclonal to Tankyrase binding protein 1
  • Host species

    Rabbit
  • Specificity

    ab197051 detects endogenous levels of total Tankyrase binding protein 1 protein.
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Tankyrase binding protein 1 aa 1601-1650. The exact sequence is proprietary.
    Sequence:

    DSDAHLFQDSTEPRASRVPSSDEEVVEEPQSRRTRMSLGTKGLKVNLFPG


    Database link: Q9C0C2

  • Positive control

    • 293 cell extract; Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS, 0.87% Sodium chloride
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 182 kDa.

Target

  • Tissue specificity

    Detected in testis, ovary, lung, skeletal muscle, heart, prostate and pancreas, and at very low levels in brain and peripheral blood leukocytes.
  • Post-translational
    modifications

    ADP-ribosylated by TNKS1 (in vitro).
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton. Chromosome. Colocalizes with chromosomes during mitosis, and in the cytoplasm with cortical actin.
  • Information by UniProt
  • Database links

  • Alternative names

    • 182 kDa tankyrase 1 binding protein antibody
    • 182 kDa tankyrase-1-binding protein antibody
    • FLJ45975 antibody
    • KIAA1741 antibody
    • TAB182 antibody
    • Tankyrase 1 binding protein 1 182 kDa antibody
    • Tankyrase 1 binding protein 1 antibody
    • Tankyrase 1 binding protein of 182 kDa antibody
    • TB182_HUMAN antibody
    • Tnks1bp1 antibody
    see all

Images

  • All lanes : Anti-Tankyrase binding protein 1 antibody (ab197051) at 1/500 dilution

    Lane 1 : 293 cell extract
    Lane 2 : 293 cell extract with synthetic peptide

    Predicted band size: 182 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human kidney tissue labeling Tankyrase binding protein 1 with ab197051 at 10 µg/ml.

References

ab197051 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up