Overview

  • Product name

  • Description

    Rabbit polyclonal to TAP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 504-553 (

    LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL

    ) of Human TAP1 (NP_000584)

  • Positive control

    • MCF7 cell lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab83817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 87 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P 1/100.
ELISA Use at an assay dependent concentration.

Titer using peptide based assay: 1/1562500.

Target

  • Function

    Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. Also acts as a molecular scaffold for the final stage of MHC class I folding, namely the binding of peptide. Nascent MHC class I molecules associate with TAP via tapasin. Inhibited by the covalent attachment of herpes simplex virus ICP47 protein, which blocks the peptide-binding site of TAP. Inhibited by human cytomegalovirus US6 glycoprotein, which binds to the lumenal side of the TAP complex and inhibits peptide translocation by specifically blocking ATP-binding to TAP1 and prevents the conformational rearrangement of TAP induced by peptide binding. Inhibited by human adenovirus E3-19K glycoprotein, which binds the TAP complex and acts as a tapasin inhibitor, preventing MHC class I/TAP association. Expression of TAP1 is down-regulated by human Epstein-Barr virus vIL-10 protein, thereby affecting the transport of peptides into the endoplasmic reticulum and subsequent peptide loading by MHC class I molecules.
  • Involvement in disease

    Defects in TAP1 are a cause of bare lymphocyte syndrome type 1 (BLS1) [MIM:604571]; also called HLA class I deficiency. BLS1 is a class I antigen deficiency that is not accompanied by particular pathologic manifestations during the first years of life. Systemic infections have not been described. Chronic bacterial infections, often beginning in the first decade of life, are restricted to the respiratory tract.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCB family. MHC peptide exporter (TC 3.A.1.209) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 1 ABC transporter domain.
  • Domain

    The peptide-binding site is shared between the cytoplasmic loops of TAP1 and TAP2.
  • Cellular localization

    Endoplasmic reticulum membrane. The transmembrane segments seem to form a pore in the membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABC 17 antibody
    • ABC transporter MHC 1 antibody
    • ABC17 antibody
    • ABCB 2 antibody
    • ABCB2 antibody
    • Antigen peptide transporter 1 antibody
    • APT 1 antibody
    • APT1 antibody
    • ATP binding cassette sub family B (MDR/TAP) member 2 antibody
    • ATP binding cassette sub family B member 2 antibody
    • ATP binding cassette transporter antibody
    • ATP-binding cassette sub-family B member 2 antibody
    • D6S114E antibody
    • FLJ26666 antibody
    • FLJ41500 antibody
    • Peptide supply factor 1 antibody
    • Peptide transporter involved in antigen processing 1 antibody
    • Peptide transporter PSF 1 antibody
    • Peptide transporter PSF1 antibody
    • Peptide transporter TAP 1 antibody
    • Peptide transporter TAP1 antibody
    • PSF 1 antibody
    • PSF-1 antibody
    • PSF1 antibody
    • Really interesting new gene 4 protein antibody
    • RING 4 antibody
    • RING4 antibody
    • TAP 1 antibody
    • TAP1 antibody
    • TAP1*0102N antibody
    • TAP1_HUMAN antibody
    • TAP1N antibody
    • Transporter 1 ATP binding cassette sub family B (MDR/TAP) antibody
    • Transporter 1 ATP binding cassette sub family B antibody
    • Transporter associated with antigen processing antibody
    • Transporter ATP binding cassette major histocompatibility complex 1 antibody
    • Y3 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung tissue labelling TAP1 with ab83817 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the cytoplasm of alveolar type I and II cells. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - TAP1. Right - Merge.
  • Anti-TAP1 antibody (ab83817) at 1 µg/ml (in 5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 87 kDa
    Observed band size: 95 kDa
    why is the actual band size different from the predicted?

References

This product has been referenced in:

  • Tran L  et al. Cisplatin Alters Antitumor Immunity and Synergizes with PD-1/PD-L1 Inhibition in Head and Neck Squamous Cell Carcinoma. Cancer Immunol Res 5:1141-1151 (2017). Read more (PubMed: 29097421) »
See 1 Publication for this product

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (spleen)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: CC1 solution (Ventana)
Permeabilization
No
Specification
spleen
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: RT°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Apr 13 2019

Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Human Tissue sections (Human Placental Explants)
Antigen retrieval step
None
Permeabilization
Yes - 4% PFA
Specification
Human Placental Explants
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Paraformaldehyde

Dr. Angela Crespo

Verified customer

Submitted Feb 13 2018

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (Primary Macrophages)
Permeabilization
Yes - 0.2% Triton x-100
Specification
Primary Macrophages
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 25°C
Fixative
Paraformaldehyde

Daniel Mott

Verified customer

Submitted Aug 21 2017

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Placenta)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate Buffer, pH 6.0
Permeabilization
No
Specification
Placenta
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 22°C
Fixative
Formaldehyde

Jeremiah Gaudet

Verified customer

Submitted Jul 27 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up