Overview

  • Product name

    Anti-TAP2 antibody
  • Description

    Rabbit polyclonal to TAP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human TAP2 aa 430-680.
    Sequence:

    YGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPN RPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLL DEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAA AQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLI LDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGK L


    Database link: Q03519

  • Positive control

    • Recombinant Human TAP2 protein (ab132658) can be used as a positive control in WB. Human placenta extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab180611 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 76 kDa.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. Also acts as a molecular scaffold for the final stage of MHC class I folding, namely the binding of peptide. Nascent MHC class I molecules associate with TAP via tapasin. Inhibited by the covalent attachment of herpes simplex virus ICP47 protein, which blocks the peptide-binding site of TAP. Inhibited by human cytomegalovirus US6 glycoprotein, which binds to the lumenal side of the TAP complex and inhibits peptide translocation by specifically blocking ATP-binding to TAP1 and prevents the conformational rearrangement of TAP induced by peptide binding. Inhibited by human adenovirus E3-19K glycoprotein, which binds the TAP complex and acts as a tapasin inhibitor, preventing MHC class I/TAP association.
  • Involvement in disease

    Bare lymphocyte syndrome 1
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCB family. MHC peptide exporter (TC 3.A.1.209) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 1 ABC transporter domain.
  • Domain

    The peptide-binding site is shared between the cytoplasmic loops of TAP1 and TAP2.
  • Cellular localization

    Endoplasmic reticulum membrane. The transmembrane segments seem to form a pore in the membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABC transporter, MHC 2 antibody
    • ABC18 antibody
    • ABCB3 antibody
    • Antigen peptide transporter 2 antibody
    • APT2 antibody
    • ATP binding cassette, sub family B (MDR/TAP), member 3 antibody
    • ATP-binding cassette sub-family B member 3 antibody
    • D6S217E antibody
    • Peptide supply factor 2 antibody
    • Peptide transporter involved in antigen processing 2 antibody
    • Peptide transporter PSF2 antibody
    • Peptide transporter TAP2 antibody
    • PSF 2 antibody
    • PSF-2 antibody
    • PSF2 antibody
    • Really interesting new gene 11 protein antibody
    • RING 11 antibody
    • RING11 antibody
    • TAP 2 antibody
    • Tap2 antibody
    • TAP2_HUMAN antibody
    • Transporter 2 ATP binding cassette sub family B antibody
    • Transporter 2, ABC (ATP binding cassette antibody
    • Transporter 2, ATP binding cassette, sub family B (MDR/TAP) antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab180611. Blue DAPI for nuclear staining.
  • Anti-TAP2 antibody (ab180611) at 1/500 dilution + Human placenta extract

    Predicted band size: 76 kDa

References

This product has been referenced in:

  • Tran L  et al. Cisplatin Alters Antitumor Immunity and Synergizes with PD-1/PD-L1 Inhibition in Head and Neck Squamous Cell Carcinoma. Cancer Immunol Res 5:1141-1151 (2017). Read more (PubMed: 29097421) »
  • Dellgren C  et al. Low Constitutive Cell Surface Expression of HLA-B Is Caused by a Posttranslational Mechanism Involving Glu180 and Arg239. J Immunol 197:4807-4816 (2016). Read more (PubMed: 27821669) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180611.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up