Overview

  • Product name

  • Description

    Rabbit polyclonal to TAPBP-R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to Mouse TAPBP-R aa 61-110 (N terminal).
    Sequence:

    RERALLVLKQVPVLDDGSLEGITDFQGSTETKQDSPVIFEASVDLVQIPQ


    Database link: NP_663366

  • Positive control

    • Mouse brain lysate.
  • General notes

    Previously labelled as Tapasin Related Protein. 

Properties

Applications

Our Abpromise guarantee covers the use of ab123238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Sequence similarities

    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane. Endoplasmic reticulum membrane. Microsome membrane. Mainly found in endoplasmic reticulum but a minority is found on the cell surface.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ10143 antibody
    • TAP binding protein like antibody
    • TAP binding protein related antibody
    • TAP binding protein related protein antibody
    • TAP-binding protein-like antibody
    • TAP-binding protein-related protein antibody
    • Tapasin like antibody
    • Tapasin R antibody
    • Tapasin Related Protein antibody
    • Tapasin-like antibody
    • TAPASIN-R antibody
    • Tapasin-related protein antibody
    • TAPBP L antibody
    • TAPBP R antibody
    • TAPBP-R antibody
    • Tapbpl antibody
    • TAPBPR antibody
    • TPSNR_HUMAN antibody
    see all

Images

  • Anti-TAPBP-R antibody (ab123238) at 1 µg/ml + Mouse brain lysate at 10 µg

    Secondary
    Goat anti-Rabbit IgG HRP

    Predicted band size: 49 kDa



    Gel concentration: 12%.

References

ab123238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Rabbit Cell lysate - whole cell (Human 293T cells (3 lanes) and human PBMC)
Gel Running Conditions
Reduced Denaturing (4-12% Bis-Tris gel)
Loading amount
20 µg
Specification
Human 293T cells (3 lanes) and human PBMC
Blocking step
Milk as blocking agent for 1 hour(s) and 30 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted May 23 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up