Overview

  • Product name

  • Description

    Rabbit polyclonal to TAPP-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TAPP-1 aa 285-404.
    Sequence:

    SGAIVAQRGPGRSASSEHPPGPSESKHAFRPTNAATATSHSTASRSNSLV STFTMEKRGFYESLAKVKPGNFKVQTVSPREPASKVTEQALLRPQSKNGP QEKDCDLVDLDDASLPVSDV


    Database link: Q9HB21

  • Positive control

    • WB: A549 whole cell lysate. IHC-P: Human thyroid and colon cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 46 kDa (predicted molecular weight: 46 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Binds specifically to phosphatidylinositol 3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. May recruit other proteins to the plasma membrane.
  • Tissue specificity

    Highly expressed in skeletal muscle, thymus, pancreas, placenta and lung. Detected at low levels in brain, heart, peripheral blood leukocytes, testis, ovary, spinal cord, thyroid, kidney, liver, small intestine and colon.
  • Sequence similarities

    Contains 2 PH domains.
  • Domain

    Binds to membranes enriched in PtdIns3,4P2 via the C-terminal PH domain.
  • Cellular localization

    Cytoplasm. Cell membrane. Nucleus. Locates to the plasma membrane after treatments that stimulate the production of PtdIns3,4P2.
  • Information by UniProt
  • Database links

  • Alternative names

    • OTTHUMP00000020651 antibody
    • PH domain containing family A member 1 antibody
    • PH domain-containing family A member 1 antibody
    • PKHA1_HUMAN antibody
    • Pleckstrin homology domain containing A1 antibody
    • Pleckstrin homology domain containing family A member 1 antibody
    • Pleckstrin homology domain containing, family A (phosphoinositide binding specific) member antibody
    • Pleckstrin homology domain-containing family A member 1 antibody
    • PLEKHA1 antibody
    • Tandem PH domain containing protein 1 antibody
    • Tandem PH domain-containing protein 1 antibody
    • TAPP 1 antibody
    • TAPP-1 antibody
    • TAPP1 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for TAPP-1 using ab230204 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thyroid tissue stained for TAPP-1 using ab230204 at 1/100 dilution in immunohistochemical analysis.

  • Anti-TAPP-1 antibody (ab230204) at 1/1000 dilution + A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 46 kDa
    Observed band size: 46 kDa

References

ab230204 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230204.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up