Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716)
- Datasheet
- References (5)
- Protocols
Overview
-
Product name
Anti-Tartrate Resistant Acid Phosphatase antibody
See all Tartrate Resistant Acid Phosphatase primary antibodies -
Description
Rabbit polyclonal to Tartrate Resistant Acid Phosphatase -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human Tartrate Resistant Acid Phosphatase aa 76-325.
Sequence:TGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSK ISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERP RDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLR PLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVP NGYLRFHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPRRARP
Database link: P13686 -
Positive control
- BT474, Jurkat and Mouse liver extracts.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.3
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab185716 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/2000. Predicted molecular weight: 37 kDa. | |
| IHC-P | 1/50 - 1/200. | |
| ICC/IF | Use at an assay dependent concentration. |
Target
-
Function
Involved in osteopontin/bone sialoprotein dephosphorylation. Its expression seems to increase in certain pathological states such as Gaucher and Hodgkin diseases, the hairy cell, the B-cell, and the T-cell leukemias. -
Sequence similarities
Belongs to the metallophosphoesterase superfamily. Purple acid phosphatase family. -
Cellular localization
Lysosome. - Information by UniProt
-
Database links
- Entrez Gene: 54 Human
- Entrez Gene: 11433 Mouse
- Entrez Gene: 25732 Rat
- Omim: 171640 Human
- SwissProt: P13686 Human
- SwissProt: Q05117 Mouse
- SwissProt: P29288 Rat
- Unigene: 1211 Human
see all -
Alternative names
- Type 5 acid phosphatase antibody
- Acid phosphatase 5 tartrate resistant antibody
- Acid phosphatase 5, tartrate resistant antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716)Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab185716. Blue DAPI for nuclear staining. -
Western blot - Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716)All lanes : Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716) at 1/500 dilution
Lane 1 : BT474 cell extract
Lane 2 : Jurkat cell extract
Lane 3 : Mouse liver extract
Predicted band size: 37 kDa
Protocols
Datasheets and documents
References
This product has been referenced in:
- Huang Y et al. Long Noncoding RNA-H19 Contributes to Atherosclerosis and Induces Ischemic Stroke via the Upregulation of Acid Phosphatase 5. Front Neurol 10:32 (2019). Read more (PubMed: 30778327) »
- Gao B et al. Macrophage-lineage TRAP+ cells recruit periosteum-derived cells for periosteal osteogenesis and regeneration. J Clin Invest 129:2578-2594 (2019). Read more (PubMed: 30946695) »
