For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    tartrate-resistant-acid-phosphatase-antibody-ab185716.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Macrophage / Inflamm.
Share by email

Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716)

  • Datasheet
  • SDS
Submit a review Submit a question References (7)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716)
  • Western blot - Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716)

Key features and details

  • Rabbit polyclonal to Tartrate Resistant Acid Phosphatase
  • Suitable for: WB, ICC/IF
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
Protein
Product image
Recombinant human Tartrate Resistant Acid Phosphatase protein (Active) (ab222972)
Stain
Product image
Oil Red O (Lipid Stain) Solution (ab223796)

View more associated products

Overview

  • Product name

    Anti-Tartrate Resistant Acid Phosphatase antibody
    See all Tartrate Resistant Acid Phosphatase primary antibodies
  • Description

    Rabbit polyclonal to Tartrate Resistant Acid Phosphatase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Tartrate Resistant Acid Phosphatase aa 76-325.
    Sequence:

    TGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSK ISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERP RDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLR PLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVP NGYLRFHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPRRARP


    Database link: P13686
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Immunology
    • Innate Immunity
    • Macrophage / Inflamm.
    • Signal Transduction
    • Protein Trafficking
    • Organelle Proteins
    • Signal Transduction
    • Cytoskeleton / ECM
    • Extracellular Matrix
    • Structures
    • Bone
    • Signal Transduction
    • Metabolism
    • Vitamins / Minerals
    • Metabolism
    • Pathways and Processes
    • Cofactors, Vitamins / minerals
    • Vitamins / minerals

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • Anti-Tartrate Resistant Acid Phosphatase antibody [rACP5/1070] (ab238033)
    • Mouse liver tissue lysate - total protein (ab29301)
    • Jurkat whole cell lysate (ab30128)
    • Jurkat whole cell lysate (ab7899)
  • Recombinant Protein

    • Recombinant human Tartrate Resistant Acid Phosphatase protein (Active) (ab222972)

Applications

Our Abpromise guarantee covers the use of ab185716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 37 kDa.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    Involved in osteopontin/bone sialoprotein dephosphorylation. Its expression seems to increase in certain pathological states such as Gaucher and Hodgkin diseases, the hairy cell, the B-cell, and the T-cell leukemias.
  • Sequence similarities

    Belongs to the metallophosphoesterase superfamily. Purple acid phosphatase family.
  • Cellular localization

    Lysosome.
  • Target information above from: UniProt accession P13686 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 54 Human
    • Entrez Gene: 11433 Mouse
    • Entrez Gene: 25732 Rat
    • Omim: 171640 Human
    • SwissProt: P13686 Human
    • SwissProt: Q05117 Mouse
    • SwissProt: P29288 Rat
    • Unigene: 1211 Human
    • Unigene: 46354 Mouse
    • Unigene: 171928 Rat
    see all
  • Alternative names

    • Type 5 acid phosphatase antibody
    • Acid phosphatase 5 tartrate resistant antibody
    • Acid phosphatase 5, tartrate resistant antibody
    • ACP5 antibody
    • EC 3.1.3.2 antibody
    • MGC117378 antibody
    • PPA5_HUMAN antibody
    • serum band 5 tartrate-resistant acid phosphatase antibody
    • SPENCDI antibody
    • T5ap antibody
    • Tartrate resistant acid ATPase antibody
    • Tartrate resistant acid phosphatase type 5 antibody
    • Tartrate resistant acid phosphatase type 5 precursor antibody
    • Tartrate-resistant acid ATPase antibody
    • Tartrate-resistant acid phosphatase type 5 antibody
    • TR AP antibody
    • TR-AP antibody
    • TRACP 5 antibody
    • TRAP antibody
    • TrATPase antibody
    • Type 5 acid phosphatase antibody
    see all

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716)
    Immunocytochemistry/ Immunofluorescence - Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716)
    Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab185716. Blue DAPI for nuclear staining.
  • Western blot - Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716)
    Western blot - Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716)
    All lanes : Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716) at 1/500 dilution

    Lane 1 : BT474 cell extract
    Lane 2 : Jurkat cell extract
    Lane 3 : Mouse liver extract

    Predicted band size: 37 kDa

Protocols

  • Immunocytochemistry & immunofluorescence protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
    • SDS
  • References (7)

    Publishing research using ab185716? Please let us know so that we can cite the reference in this datasheet.

    ab185716 has been referenced in 7 publications.

    • He DD  et al. C-KIT Expression Distinguishes Fetal from Postnatal Skeletal Progenitors. Stem Cell Reports 14:614-630 (2020). PubMed: 32220331
    • Gao B  et al. Macrophage-lineage TRAP+ cells recruit periosteum-derived cells for periosteal osteogenesis and regeneration. J Clin Invest 129:2578-2594 (2019). PubMed: 30946695
    • Ni S  et al. Sensory innervation in porous endplates by Netrin-1 from osteoclasts mediates PGE2-induced spinal hypersensitivity in mice. Nat Commun 10:5643 (2019). PubMed: 31822662
    • Huang Y  et al. Long Noncoding RNA-H19 Contributes to Atherosclerosis and Induces Ischemic Stroke via the Upregulation of Acid Phosphatase 5. Front Neurol 10:32 (2019). PubMed: 30778327
    • Debnath S  et al. Discovery of a periosteal stem cell mediating intramembranous bone formation. Nature 562:133-139 (2018). PubMed: 30250253
    • Hsu LF  et al. 970?nm low-level laser affects bone metabolism in orthodontic tooth movement. J Photochem Photobiol B 186:41-50 (2018). PubMed: 30005205
    • Seike M  et al. Stem cell niche-specific Ebf3 maintains the bone marrow cavity. Genes Dev 32:359-372 (2018). PubMed: 29563184

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab185716.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.