Overview

  • Product name

    Anti-TAS2R38 antibody
  • Description

    Rabbit polyclonal to TAS2R38
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human TAS2R38 aa 212-251.
    Sequence:

    SSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLVS


    Database link: P59533

  • Positive control

    • IHC-P: Human liver tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222859 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5.
  • Tissue specificity

    Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells. Expressed in testis (PubMed:16720576).
  • Sequence similarities

    Belongs to the G-protein coupled receptor T2R family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • PTC antibody
    • PTC bitter taste receptor antibody
    • T2R38 antibody
    • T2R38_HUMAN antibody
    • T2R61 antibody
    • TAS2R38 antibody
    • Taste 2 receptor member 38 antibody
    • Taste receptor type 2 member 38 antibody
    • Taste receptor type 2 member 61 antibody
    • taste receptor, type 2, member 38 antibody
    see all

Images

  • Paraffin-embedded human ovarian cancer tissue stained for TAS2R38 using ab222859 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for TAS2R38 (green) using ab222859 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L).

References

ab222859 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222859.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up