For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    tata-binding-protein-tbp-antibody-ab28175.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Transcription Polymerase associated factors Pol II Transcription TFIIB
Share by email

Anti-TATA binding protein TBP antibody (ab28175)

  • Datasheet
  • SDS
Reviews (3)Q&A (2)References (13)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

ChIP - Anti-TATA binding protein TBP antibody (ab28175)
  • ChIP - Anti-TATA binding protein TBP antibody (ab28175)

Key features and details

  • Rabbit polyclonal to TATA binding protein TBP
  • Suitable for: ChIP
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Primary
Product image
HRP Anti-Cardiac Troponin I antibody [MF4] (ab10239)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
Knockout
Product image
Human TBP (TATA binding protein TBP) knockout HeLa cell lysate (ab257290)

View more associated products

Overview

  • Product name

    Anti-TATA binding protein TBP antibody
    See all TATA binding protein TBP primary antibodies
  • Description

    Rabbit polyclonal to TATA binding protein TBP
  • Host species

    Rabbit
  • Specificity

    Ab28175 recognises TATA binding protein TBP.
  • Tested Applications & Species

    Application Species
    ChIP
    Human
    See all applications and species data
  • Immunogen

    Recombinant full length TATA binding protein TBP (Human).

  • General notes

    We are constantly working hard to ensure we provide our customers with best in class antibodies. As a result of this work we are pleased to now offer this antibody in purified format. We are in the process of updating our datasheets. The purified format is designated 'PUR' on our product labels. If you have any questions regarding this update, please contact our Scientific Support team.

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.9
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Polymerase associated factors
    • Pol II Transcription
    • TFIIB
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Polymerase associated factors
    • Pol II Transcription
    • TAFs
    • Isotype/Loading Controls
    • Loading Controls
    • TBP - Nuclear
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Preinitiation complex

Associated products

  • ChIP Related Products

    • Rabbit Anti-Mouse IgG H&L (ab46540)
  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • HeLa nuclear extract lysate (ab14655)
  • Recombinant Protein

    • Recombinant Human TATA binding protein TBP (ab81897)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab28175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Guaranteed

Tested applications are guaranteed to work and covered by our Abpromise guarantee.

Predicted

Predicted to work for this combination of applications and species but not guaranteed.

Incompatible

Does not work for this combination of applications and species.

Application Species
ChIP
Human
Application Abreviews Notes
ChIP (2)
Use 5-10 µg for 25 µg of chromatin.
Notes
ChIP
Use 5-10 µg for 25 µg of chromatin.

Target

  • Function

    General transcription factor that functions at the core of the DNA-binding multiprotein factor TFIID. Binding of TFIID to the TATA box is the initial transcriptional step of the pre-initiation complex (PIC), playing a role in the activation of eukaryotic genes transcribed by RNA polymerase II. Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1 with the rDNA promoter. SL1 is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA.
  • Tissue specificity

    Widely expressed, with levels highest in the testis and ovary.
  • Involvement in disease

    Defects in TBP are the cause of spinocerebellar ataxia type 17 (SCA17) [MIM:607136]. Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA17 is an autosomal dominant cerebellar ataxia (ADCA) characterized by widespread cerebral and cerebellar atrophy, dementia and extrapyramidal signs. The molecular defect in SCA17 is the expansion of a CAG repeat in the coding region of TBP. Longer expansions result in earlier onset and more severe clinical manifestations of the disease.
  • Sequence similarities

    Belongs to the TBP family.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession P20226 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 6908 Human
    • Omim: 600075 Human
    • SwissProt: P20226 Human
    • Unigene: 1100 Human
    • Unigene: 590872 Human
    • Alternative names

      • GTF2D antibody
      • GTF2D1 antibody
      • HDL4 antibody
      • MGC117320 antibody
      • MGC126054 antibody
      • MGC126055 antibody
      • SCA17 antibody
      • TATA binding factor antibody
      • TATA box factor antibody
      • TATA sequence binding protein antibody
      • TATA sequence-binding protein antibody
      • TATA-binding factor antibody
      • TATA-box binding protein N-terminal domain antibody
      • TATA-box factor antibody
      • TATA-box-binding protein antibody
      • TBP antibody
      • TBP_HUMAN antibody
      • TFIID antibody
      • Transcription initiation factor TFIID TBP subunit antibody
      see all

    Images

    • ChIP - Anti-TATA binding protein TBP antibody (ab28175)
      ChIP - Anti-TATA binding protein TBP antibody (ab28175)This image is courtesy of an anonymous Abreview

      ChIP analysis using ab28175 binding TATA binding protein TBP in mouse liver nuclear tissue lysate. Cells were cross-linked for 10 minutes with 1% paraformaldehyde. Samples were incubated with primary antibody for 16 hours at 4°C in TE pH8, 150mM NaCl, Trition 1%, SDS 0,1%. Protein binding was detected using real-time PCR.
      Negative Control: beads.

      See Abreview

    • ChIP - Anti-TATA binding protein TBP antibody (ab28175)
      ChIP - Anti-TATA binding protein TBP antibody (ab28175)

      Chromatin was prepared from Hela cells according to the Abcam X-ChIP protocol. Cells were fixed with formaldehyde for 10min. The  ChIP was performed with 25µg of chromatin, 8µg of  ab28175 (blue), and 20µl of Protein A/G sepharose beads. No antibody was added to the beads control (yellow). The immunoprecipitated DNA was quantified by real time PCR (Taqman and sybr green approach). Primers and probes are located either in the core promoter of the gene (TATA) or in the open reading frame (ORF).
          

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (13)

    Publishing research using ab28175? Please let us know so that we can cite the reference in this datasheet.

    ab28175 has been referenced in 13 publications.

    • Le SN  et al. The TAFs of TFIID Bind and Rearrange the Topology of the TATA-Less RPS5 Promoter. Int J Mol Sci 20:N/A (2019). PubMed: 31277458
    • Sachini N  et al. Promyelocytic leukemia protein (PML) controls breast cancer cell proliferation by modulating Forkhead transcription factors. Mol Oncol 13:1369-1387 (2019). PubMed: 30927552
    • Gilbertson S  et al. Changes in mRNA abundance drive shuttling of RNA binding proteins, linking cytoplasmic RNA degradation to transcription. Elife 7:N/A (2018). PubMed: 30281021
    • Wu B  et al. Aldehyde dehydrogenase 2 activation in aged heart improves the autophagy by reducing the carbonyl modification on SIRT1. Oncotarget 7:2175-88 (2016). Mouse . PubMed: 26741505
    • Martianov I  et al. TRF2 is recruited to the pre-initiation complex as a testis-specific subunit of TFIIA/ALF to promote haploid cell gene expression. Sci Rep 6:32069 (2016). Mouse . PubMed: 27576952
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-5 of 5 Abreviews or Q&A

    Western blot abreview for Anti-TATA binding protein TBP antibody

    Average
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Arabidopsis thaliana Tissue lysate - whole (4 week old rosettes)
    Gel Running Conditions
    Reduced Denaturing (12% akrylamide)
    Loading amount
    40 µg
    Specification
    4 week old rosettes
    Blocking step
    Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 22°C
    Read More

    Abcam user community

    Verified customer

    Submitted May 14 2019

    ChIP abreview for Anti-TATA binding protein TBP antibody - ChIP Grade

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    ChIP
    Detection step
    Real-time PCR
    Sample
    Mouse Tissue lysate - nuclear (Liver)
    Specification
    Liver
    Negative control
    beads
    Type
    Cross-linking (X-ChIP)
    Duration of cross-linking step: 10 minute(s) and 0 second(s)
    Specification of the cross-linking agent: PFA 1%
    Read More

    Abcam user community

    Verified customer

    Submitted Nov 12 2012

    Question

    Dear Sir/Madam,

    Is it possible to get some free samples of these products?
    We will be making many purchases in the future. Even a discount would be great.

    Best Regards,

    Read More

    Abcam community

    Verified customer

    Asked on May 23 2012

    Answer

    Thank you for your message.

    I am pleased to let you know I now have further information regarding ab24685 and ab61411

    ab24685
    Our datasheet says that this reacts with AA 41-57 of the human sequence. This has11% alignment with the Methanococcoides burtonii sequence you provided.I am sorry that we would therefore not expect this antibody to detect.

    ab61411
    The immunogen used to raisethis antibodywas Drosophila TFIID complex (Gene ID: 37476). This has 27% alignment with the Methanococcoides burtonii sequence you provided.I am sorry that we woudl therefore not expect this antibody to detect.

    Please note we cannot guarantee that any of these three antibodies would work in the Methanococcoides burtonii. As a gesture of goodwill, Iam able to provide a 5% discount for you, but I am sorry I would not expect positive results.

    In order to receive the discount, please provide the following discount code when placing the order: 5PC-OFF-T7T62.

    I hope this will be helpful. If you have any further questions, please do not hesitate to contactus.

    Read More

    Abcam Scientific Support

    Answered on May 23 2012

    Question

    Dear Sir/Madam,

    I have a technical enquiry:

    Would any of these antibodies react with TBP fromMethanococcoides burtonii(Mbur_1496) for Western blot and ChIP protocols? I have pasted in the protein sequence below.

    ab61411, ab24685, ab28175

    Mbur_1496:

    MSESNIKIENVVASTELAEESKNMSEYNIKIENVVASTKLAEEFDLIKIE

    AEFEGAEYNKQKFPGLVYRVTDPKAAFLVFTSGKVVCTGAKNVADVHIVI

    GNMAKKLNGIGIETIADPEITVQNIVASADLHATLNLNAIAIGLGLENIE

    YEPEQFPGLVYRIADPKVVVLIFSSGKLVVTGGKSPAHCDQGVEVVRQQL

    DNMGLL

    Thanks for your help.

    Kind regards,

    Read More

    Abcam community

    Verified customer

    Asked on May 22 2012

    Answer

    Thank you for contacting us and for your interest in our products.

    As far as we are aware, these TATA binding protein antibodies (ab61411, ab24685, ab28175) have never been tested with samples from Methanococcoides burtonii. All tested species cross-reactivity information is stated on our datasheets, and these are updated as soon as any new information is brought to our attention.

    As you requested this information as urgent, I can confirm the following information that I have collected so far:

    ab28175: I can confirm this is tested and guaranteed in WB and ChIP. All tested and guaranteed applications are listed on the online datasheet, and these are updated as soon as we receive any new information. The immunogen, as stated on the datasheet, is recombinant full length TATA binding protein TBP (Human). I have checked the alignment of the human protein with the sequence you have kindly provided, I am sorry this is regrettably low at 27%. We would therefore not expect this antibody to detect the Methanococcoides burtoniiprotein.

    ab24685: I am sorry this is tested and guaranteed in WB and Gel supershift assays only, It has not yet been tested in ChIP. I am currently contacting our source to obtain more specific details regarding the immunogen so I can check the alignment with the Methanococcoides burtoniisequence for you.

    ab61411: I am sorry this is tested and guaranteed in WB andIP only, It has not yet been tested in ChIP. I am currently contacting our source to obtain more specific details regarding the immunogen so I can check the alignment with the Methanococcoides burtoniiseqeuence for you.

    I will get back to you as soon as I have further information regarding ab24685 and ab61411.Thank you for your patience. If you require any further information, please do not hesitate to let me know.

    Read More

    Abcam Scientific Support

    Answered on May 22 2012

    ChIP abreview for Anti-TATA binding protein TBP antibody - ChIP Grade

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    ChIP
    Sample
    Mouse Cell lysate - whole cell (3T3 cells)
    Specification
    3T3 cells
    Type
    Cross-linking (X-ChIP)
    Duration of cross-linking step: 10 minute(s) and 0 second(s)
    Specification of the cross-linking agent: formaldehyde
    Detection step
    Real-time PCR
    Negative control
    anti-CD30
    Read More

    Abcam user community

    Verified customer

    Submitted Feb 11 2009

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.