For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    tata-binding-protein-tbp-antibody-nuclear-loading-control-and-chip-grade-ab63766.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Transcription Polymerase associated factors Pol II Transcription TFIIB
Share by email

Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)

  • Datasheet
  • SDS
Reviews (7)Q&A (2)References (34)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

ChIP - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
  • Western blot - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
  • Immunoprecipitation - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
  • Western blot - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
  • Western blot - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)

Key features and details

  • Rabbit polyclonal to TATA binding protein TBP - Nuclear Loading Control and ChIP Grade
  • Suitable for: IP, ICC/IF, ChIP, IHC-P, WB
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

Get better batch-to-batch reproducibility with a recombinant antibody

Product image
Anti-TATA binding protein TBP antibody [EPR21954] - ChIP Grade (ab220788)
  • Research with confidence – consistent and reproducible results with every batch
  • Long-term and scalable supply – powered by recombinant technology for fast production
  • Success from the first experiment – confirmed specificity through extensive validation
  • Ethical standards compliant – production is animal-free

Overview

  • Product name

    Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade
    See all TATA binding protein TBP primary antibodies
  • Description

    Rabbit polyclonal to TATA binding protein TBP - Nuclear Loading Control and ChIP Grade
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, ICC/IF, ChIP, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chicken, Cow
  • Immunogen

    Synthetic peptide. This information is proprietary to Abcam and/or its suppliers.

  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituent: PBS

    Batches of this product that have a concentration < 1mg/ml may have BSA added as a stabilising agent. If you would like information about the formulation of a specific lot, please contact our scientific support team who will be happy to help.
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Polymerase associated factors
    • Pol II Transcription
    • TFIIB
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Polymerase associated factors
    • Pol II Transcription
    • TAFs
    • Isotype/Loading Controls
    • Loading Controls
    • TBP - Nuclear
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Preinitiation complex
    • Epigenetics and Nuclear Signaling
    • ChIP assays
    • ChIP antibodies

Associated products

  • ChIP Related Products

    • ChIP Kit (ab500)
  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant Human TATA binding protein TBP (ab81897)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab63766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP
Use at an assay dependent concentration.
ICC/IF (2)
Use at an assay dependent concentration.
ChIP
Use 5 µg for 25 µg of chromatin.
IHC-P (1)
Use a concentration of 10 µg/ml.
WB (3)
Use a concentration of 1 µg/ml. Detects a band of approximately 45 kDa (predicted molecular weight: 38 kDa).
Notes
IP
Use at an assay dependent concentration.
ICC/IF
Use at an assay dependent concentration.
ChIP
Use 5 µg for 25 µg of chromatin.
IHC-P
Use a concentration of 10 µg/ml.
WB
Use a concentration of 1 µg/ml. Detects a band of approximately 45 kDa (predicted molecular weight: 38 kDa).

Target

  • Function

    General transcription factor that functions at the core of the DNA-binding multiprotein factor TFIID. Binding of TFIID to the TATA box is the initial transcriptional step of the pre-initiation complex (PIC), playing a role in the activation of eukaryotic genes transcribed by RNA polymerase II. Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1 with the rDNA promoter. SL1 is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA.
  • Tissue specificity

    Widely expressed, with levels highest in the testis and ovary.
  • Involvement in disease

    Defects in TBP are the cause of spinocerebellar ataxia type 17 (SCA17) [MIM:607136]. Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA17 is an autosomal dominant cerebellar ataxia (ADCA) characterized by widespread cerebral and cerebellar atrophy, dementia and extrapyramidal signs. The molecular defect in SCA17 is the expansion of a CAG repeat in the coding region of TBP. Longer expansions result in earlier onset and more severe clinical manifestations of the disease.
  • Sequence similarities

    Belongs to the TBP family.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession P20226 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 395995 Chicken
    • Entrez Gene: 6908 Human
    • Entrez Gene: 21374 Mouse
    • Entrez Gene: 117526 Rat
    • Omim: 600075 Human
    • SwissProt: O13270 Chicken
    • SwissProt: P20226 Human
    • SwissProt: P29037 Mouse
    • Unigene: 590872 Human
    • Unigene: 244820 Mouse
    see all
  • Alternative names

    • GTF2D antibody
    • GTF2D1 antibody
    • HDL4 antibody
    • MGC117320 antibody
    • MGC126054 antibody
    • MGC126055 antibody
    • SCA17 antibody
    • TATA binding factor antibody
    • TATA box factor antibody
    • TATA sequence binding protein antibody
    • TATA sequence-binding protein antibody
    • TATA-binding factor antibody
    • TATA-box binding protein N-terminal domain antibody
    • TATA-box factor antibody
    • TATA-box-binding protein antibody
    • TBP antibody
    • TBP_HUMAN antibody
    • TFIID antibody
    • Transcription initiation factor TFIID TBP subunit antibody
    see all

Images

  • ChIP - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
    ChIP - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
    Chromatin was prepared from HeLa cells according to the Abcam X-ChIP protocol. Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 25µg of chromatin, 5µg of ab63766 (blue), and 20µl of Protein A/G sepharose beads. No antibody was added to the beads control (yellow). The immunoprecipitated DNA was quantified by real time PCR (Sybr green approach for active loci and Taqman approach for inactive loci). Primers and probes are located in the first kb of the transcribed region.
  • Western blot - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
    Western blot - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
    All lanes : Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766) at 1 µg/ml

    Lane 1 : Testis (Mouse) Tissue Lysate
    Lane 2 : NIH 3T3 (Mouse embryonic fibroblast cell line) Whole Cell Lysate
    Lane 3 : Testis (Rat) Tissue Lysate
    Lane 4 : Hep G2 nuclear extract lysate (ab14660)

    Lysates/proteins at 10 µg per lane.

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG - H&L - Pre-Adsorbed (HRP) at 1/3000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 38 kDa
    Observed band size: 38,45 kDa why is the actual band size different from the predicted?
    Additional bands at: 55 kDa. We are unsure as to the identity of these extra bands.


    Exposure time: 3 minutes
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)This image is courtesy of an anonymous Abreview

    ab63766 staining TAT binding protein TBP in human infantile fibromatosis tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with formaldehyde and blocked with 1% FBS/BSA for 3 hours at room temperature; antigen retrieval was by heat mediation in Tris pH9. Samples were incubated with primary antibody (1/100 in TBS + 1% BSA + 1% FBS) for 16 hours. An undiluted HRP-conjugated goat anti-rabbit IgG polyclonal was used as the secondary antibody.

    See Abreview

  • Immunoprecipitation - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
    Immunoprecipitation - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
    TATA binding protein TBP was immunoprecipitated using 0.5mg HepG2 whole cell extract, 5µg of Rabbit polyclonal to TATA binding protein TBP and 50µl of protein G magnetic beads (+). No antibody was added to the control (-).
    The antibody was incubated under agitation with Protein G beads for 10min, HepG2 whole cell extract lysate diluted in RIPA buffer was added to each sample and incubated for a further 10min under agitation.
    Proteins were eluted by addition of 40µl SDS loading buffer and incubated for 10min at 70oC; 10µl of each sample was separated on a SDS PAGE gel, transferred to a nitrocellulose membrane, blocked with 5% BSA and probed with ab63766.
    Secondary: Mouse monoclonal [SB62a] Secondary Antibody to Rabbit IgG light chain (HRP) (ab99697).
    Band: 45kDa: TATA binding protein TBP.
  • Western blot - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
    Western blot - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
    All lanes : Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766) at 1 µg/ml

    Lane 1 : Recombinant Human TATA binding protein TBP (ab81897) at 0.1 µg
    Lane 2 : Recombinant Human TATA binding protein TBP (ab81897) at 0.01 µg

    Secondary
    All lanes : Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 38 kDa


    Exposure time: 10 seconds
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)

    IHC image of TATA binding protein TBP staining in Human breast ductal carcinoma formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab63766, 10µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

  • Western blot - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
    Western blot - Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766)
    All lanes : Anti-TATA binding protein TBP antibody - Nuclear Loading Control and ChIP Grade (ab63766) at 1 µg/ml

    Lane 1 : HeLa Whole Cell Lysate
    Lane 2 : HepG2 (Human hepatocellular liver carcinoma cell line) Whole Cell Lysate

    Lysates/proteins at 10 µg per lane.

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG - H&L - Pre-Adsorbed (HRP) at 1/3000 dilution

    Performed under reducing conditions.

    Predicted band size: 38 kDa
    Observed band size: 45 kDa why is the actual band size different from the predicted?
    Additional bands at: 60 kDa. We are unsure as to the identity of these extra bands.

Protocols

  • ChIP protocols
  • Immunoprecipitation protocols
  • Immunohistochemistry protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (34)

Publishing research using ab63766? Please let us know so that we can cite the reference in this datasheet.

ab63766 has been referenced in 34 publications.

  • Kang DY  et al. Non-toxic sulfur inhibits LPS-induced inflammation by regulating TLR-4 and JAK2/STAT3 through IL-6 signaling. Mol Med Rep 24:N/A (2021). PubMed: 33907855
  • Huang S  et al. Co-expression of tissue kallikrein 1 and tissue inhibitor of matrix metalloproteinase 1 improves myocardial ischemia-reperfusion injury by promoting angiogenesis and inhibiting oxidative stress. Mol Med Rep 23:N/A (2021). PubMed: 33355364
  • Roesler AM  et al. Calcium-Sensing Receptor Contributes to Hyperoxia Effects on Human Fetal Airway Smooth Muscle. Front Physiol 12:585895 (2021). PubMed: 33790802
  • Liu Y  et al. The BRD4 inhibitor JQ1 protects against chronic obstructive pulmonary disease in mice by suppressing NF-?B activation. Histol Histopathol 36:101-112 (2021). PubMed: 33215396
  • Nasarre P  et al. Overcoming PD-1 Inhibitor Resistance with a Monoclonal Antibody to Secreted Frizzled-Related Protein 2 in Metastatic Osteosarcoma. Cancers (Basel) 13:N/A (2021). PubMed: 34070758
View all Publications for this product

Customer reviews and Q&As

Show All Reviews Q&A
Submit a question

1-2 of 2 Q&A

Question

Hello,
I am looking for an nuclear extract loading control for
western blot applications for human cells ,when i searched your
webpages, i found two products ab63766 and ab51841.
can you please tell above loading controls are suitable to all
cell/tissues lysates or they specific any to few cells or tissues
types.?
If not,can you please recommend any nuclear protein loading controls
for western blot specific to human cells or human tissue lysates?
Thank you,
Best regards

Read More

Abcam community

Verified customer

Asked on Mar 19 2013

Answer

Thank you for contacting us.

Both nuclear loading controls you are referring are suitable to use with human lysates.

Please make sure the protein to be detected in the blot has a different molecular weight than the expected for TBP (˜38KDa).

For more information about loading controls you can refer to our https://www.abcam.com/index.html?pageconfig=resource&rid=11403#B5

The Abpromise® guarantee ensures that you can trust our products, and they should work in the tested species and applications stated on the datasheet, or we will offer a replacement, credit, or refund, if reported within 6 months of purchase.

I hope this helps. For more information please do not hesitate to contact us again.

Read More

Abcam Scientific Support

Answered on Mar 19 2013

Question

Hi Abcam,

Please see below for an email we have received from a customer;

I am looking at the Abcam Anti TBP antibodies: ab818, ab51841 and ab63766.

I was wondering if you could help with a technical question, would any of these antibodies react with TBP from Methanococcoides burtonii (Mbur_1496)? I have pasted in the protein sequence below.

Mbur_1496:

MSESNIKIENVVASTELAEESKNMSEYNIKIENVVASTKLAEEFDLIKIE

AEFEGAEYNKQKFPGLVYRVTDPKAAFLVFTSGKVVCTGAKNVADVHIVI

GNMAKKLNGIGIETIADPEITVQNIVASADLHATLNLNAIAIGLGLENIE

YEPEQFPGLVYRIADPKVVVLIFSSGKLVVTGGKSPAHCDQGVEVVRQQL

DNMGLL


Thanks for your help!

Kind regards,

Read More

Abcam community

Verified customer

Asked on May 15 2012

Answer

Thank you for your enquiry.

I am sorry to confirm that as far as we are aware,these three TPB antibodies(ab818, ab51841 and ab63766) have not been tested with samples from Methanococcoides burtonii. All tested and guaranteedspecies cross-reactivity information is stated on our datasheets, and these are updated as soon as any new information is brought to our attention.

I have checked the alignment of the immunogens with the Methanococcoides burtonii.sequence kindly provided. I am sorry this indicates only 16% alignment with all three antibodies. Therefore these antibodies are regrettablynot likely to detect the TBP from this species.

I am sorry the products are not likely to be suitable for your requirements on this occasion. However, Ihope the information is helpful. Please do not hesitate to contact me for any further advice or information.

Read More

Abcam Scientific Support

Answered on May 15 2012

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.