Anti-TBC1D15 antibody - N-terminal (ab194953)
Key features and details
- Rabbit polyclonal to TBC1D15 - N-terminal
- Suitable for: IP, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-TBC1D15 antibody - N-terminal
See all TBC1D15 primary antibodies -
Description
Rabbit polyclonal to TBC1D15 - N-terminal -
Host species
Rabbit -
Tested applications
Suitable for: IP, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rabbit, Cat, Chimpanzee, Rhesus monkey, Gorilla, Common marmoset, Orangutan -
Immunogen
Synthetic peptide within Human TBC1D15 aa 1-50 (N terminal). The exact sequence is proprietary. (NP_073608.4).
Sequence:MAAAGVVSGKIIYEQEGVYIHSSCGKTNDQDGLISGILRVLEKDAEVIVD
Database link: Q8TC07 -
Positive control
- HeLa, 293T, Jurkat, TCMK-1 and NIH3T3 whole cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab194953 was affinity purified using an epitope specific to TBC1D15 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab194953 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IP | Use at 2-10 µg/mg of lysate. | |
WB | 1/1000 - 1/5000. Predicted molecular weight: 79 kDa. |
Target
-
Function
Acts as a GTPase activating protein for RAB7A. Does not act on RAB4, RAB5 or RAB6. -
Sequence similarities
Contains 1 Rab-GAP TBC domain. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 101081740 Cat
- Entrez Gene: 452079 Chimpanzee
- Entrez Gene: 100402257 Common marmoset
- Entrez Gene: 101145640 Gorilla
- Entrez Gene: 64786 Human
- Entrez Gene: 66687 Mouse
- Entrez Gene: 100171518 Orangutan
- Entrez Gene: 100352244 Rabbit
see all -
Alternative names
- DKFZp686M1379 antibody
- DKFZp761D0223 antibody
- FLJ12085 antibody
see all
Images
-
All lanes : Anti-TBC1D15 antibody - N-terminal (ab194953) at 0.4 µg/ml
Lane 1 : HeLa whole cell lysate
Lane 2 : 293T whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lane 4 : TCMK-1 whole cell lysate
Lane 5 : NIH/3T3 whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 79 kDa
Exposure time: 30 secondsWhole cell lysates prepared using NETN lysis buffer.
-
Detection of TBC1D15 in immunoprecipitates of 293T whole cell lysate (prepared using NETN lysis buffer; 1 mg for IP, 20% of IP loaded) using ab194953 at 6 µg/mg lysate for IP and at 0.4 µg/ml for subsequent Western blot detection.
Detection: Chemiluminescence with an exposure time of 30 seconds.
Protocols
Datasheets and documents
References (0)
ab194953 has not yet been referenced specifically in any publications.