Anti-TBC1D15 antibody - N-terminal (ab194953)

Submit a review Submit a question
Western blot - Anti-TBC1D15 antibody - N-terminal (ab194953)
  • Immunoprecipitation - Anti-TBC1D15 antibody - N-terminal (ab194953)

Key features and details

  • Rabbit polyclonal to TBC1D15 - N-terminal
  • Suitable for: IP, WB
  • Reacts with: Mouse, Human
  • Isotype: IgG

Overview

  • Product name

    Anti-TBC1D15 antibody - N-terminal
    See all TBC1D15 primary antibodies

  • Description

    Rabbit polyclonal to TBC1D15 - N-terminal

  • Host species

    Rabbit

  • Tested applications

    Suitable for: IP, WBmore details

  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rabbit, Cat, Chimpanzee, Rhesus monkey, Gorilla, Common marmoset, Orangutan

  • Immunogen

    Synthetic peptide within Human TBC1D15 aa 1-50 (N terminal). The exact sequence is proprietary. (NP_073608.4).
    Sequence:

    MAAAGVVSGKIIYEQEGVYIHSSCGKTNDQDGLISGILRVLEKDAEVIVD


    Database link: Q8TC07
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • HeLa, 293T, Jurkat, TCMK-1 and NIH3T3 whole cell lysates.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...

  • Purity

    Immunogen affinity purified

  • Purification notes

    ab194953 was affinity purified using an epitope specific to TBC1D15 immobilized on solid support.

  • Clonality

    Polyclonal

  • Isotype

    IgG

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/1000 - 1/5000. Predicted molecular weight: 79 kDa.

Target

Images

  • Western blot - Anti-TBC1D15 antibody - N-terminal (ab194953)
    Western blot - Anti-TBC1D15 antibody - N-terminal (ab194953)
    All lanes : Anti-TBC1D15 antibody - N-terminal (ab194953) at 0.4 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH/3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 79 kDa


    Exposure time: 30 seconds


    Whole cell lysates prepared using NETN lysis buffer.

  • Immunoprecipitation - Anti-TBC1D15 antibody - N-terminal (ab194953)
    Immunoprecipitation - Anti-TBC1D15 antibody - N-terminal (ab194953)

    Detection of TBC1D15 in immunoprecipitates of 293T whole cell lysate (prepared using NETN lysis buffer; 1 mg for IP, 20% of IP loaded) using ab194953 at 6 µg/mg lysate for IP and at 0.4 µg/ml for subsequent Western blot detection.
    Detection: Chemiluminescence with an exposure time of 30 seconds.

References (0)

Publishing research using ab194953? Please let us know so that we can cite the reference in this datasheet.

ab194953 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab194953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com