Overview

  • Product name
    Anti-TBC1D2 antibody - N-terminal
    See all TBC1D2 primary antibodies
  • Description
    Rabbit polyclonal to TBC1D2 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human TBC1D2 aa 1-50 (N terminal). The exact sequence is proprietary.
    Sequence:

    MEGAGENAPESSSSAPGSEESARDPQVPPPEEESGDCARSLEAVPKKLCG


    Database link: Q9BYX2

  • Positive control
    • Recombinant Human TBC1D2 protein (ab163081) can be used as a positive control in WB. HeLa, 293T and Jurkat whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 105 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Relevance
    Acts as GTPase-activating protein for RAB7A. Signal effector acting as a linker between RAC1 and RAB7A, leading to RAB7A inactivation and subsequent inhibition of cadherin degradation and reduced cell-cell adhesion. Interacts with activated RAC1 and CDH1.
  • Cellular localization
    Cytoplasm. Cytoplasmic vesicle. Cell junction
  • Database links
  • Alternative names
    • PARIS 1 antibody
    • PARIS1 antibody
    • PP8997 antibody
    • Prostate antigen recognized and identified by SEREX antibody
    • TBC1 domain family, member 2 antibody
    • TBC1D2 antibody
    • TBC1D2A antibody
    see all

Images

  • All lanes : Anti-TBC1D2 antibody - N-terminal (ab176701) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : 293T whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 105 kDa


    Exposure time: 30 seconds
  • Detection of TBC1D2 by Western Blot of Immunprecipitate.

     

    Western blot using ab176701 at 0.4 µg/ml staining TBC1D2 in HeLa whole cell lysate immunoprecipitated using ab176701 at 6 µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).


    Detection: Chemiluminescence with exposure times of 3 seconds

References

ab176701 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up