Anti-TBC1D2 antibody - N-terminal (ab176701)

Overview

  • Product name
    Anti-TBC1D2 antibody - N-terminal
    See all TBC1D2 primary antibodies
  • Description
    Rabbit polyclonal to TBC1D2 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human TBC1D2 aa 1-50 (N terminal). The exact sequence is proprietary.
    Sequence:

    MEGAGENAPESSSSAPGSEESARDPQVPPPEEESGDCARSLEAVPKKLCG


    Database link: Q9BYX2

  • Positive control
    • HeLa, 293T and Jurkat whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 105 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Relevance
    Acts as GTPase-activating protein for RAB7A. Signal effector acting as a linker between RAC1 and RAB7A, leading to RAB7A inactivation and subsequent inhibition of cadherin degradation and reduced cell-cell adhesion. Interacts with activated RAC1 and CDH1.
  • Cellular localization
    Cytoplasm. Cytoplasmic vesicle. Cell junction
  • Database links
  • Alternative names
    • PARIS 1 antibody
    • PARIS1 antibody
    • PP8997 antibody
    • Prostate antigen recognized and identified by SEREX antibody
    • TBC1 domain family, member 2 antibody
    • TBC1D2 antibody
    • TBC1D2A antibody
    see all

Images

  • All lanes : Anti-TBC1D2 antibody - N-terminal (ab176701) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : 293T whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 105 kDa


    Exposure time: 30 seconds
  • Detection of TBC1D2 by Western Blot of Immunprecipitate.

     

    Western blot using ab176701 at 0.4 µg/ml staining TBC1D2 in HeLa whole cell lysate immunoprecipitated using ab176701 at 6 µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).


    Detection: Chemiluminescence with exposure times of 3 seconds

References

ab176701 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up