Overview

  • Product name

    Anti-TBC1D5 antibody
  • Description

    Rabbit polyclonal to TBC1D5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human TBC1D5 aa 537-628.
    Sequence:

    SSSPSVESLPGGREFTGSPPSSATKKDSFFSNISRSRSHSKTMGRKESEE ELEAQISFLQGQLNDLDAMCKYCAKVMDTHLVNIQDVILQEN


    Database link: Q92609

  • Positive control

    • Human colon tissue. RT4, U251 and human tonsil lysates. U251 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab203896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 89 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

Images

  • All lanes : Anti-TBC1D5 antibody (ab203896)

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 cell lysate

    Lysates/proteins at 0.4 µg/ml per lane.

    Predicted band size: 89 kDa

  • Immunocytochemical analysis of A431 cells labeling TBC1D5 beta with ab203896 at 1 �g/ml.
  • Immunohistochemical analysis of human testis tissue labeling TBC1D5 beta with ab203896 at 1/1000 dilution.
  • Immunohistochemical analysis of human fallopian tube tissue labeling TBC1D5 beta with ab203896 at 1/1000 dilution.
  • Immunohistochemical analysis of human lymph node tissue labeling TBC1D5 beta with ab203896 at 1/1000 dilution.

References

ab203896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up