Overview

  • Product name

  • Description

    Rabbit polyclonal to TBCC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human TBCC aa 2-346.
    Sequence:

    ESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEVERRKQKRQNQE VEKENSHFFVATFVRERAAVEELLERAESVERLEEAASRLQGLQKLINDS VFFLAAYDLRQGQEALARLQAALAERRRGLQPKKRFAFKTRGKDAASSTK VDAAPGIPPAVESIQDSPLPKKAEGDLGPSWVCGFSNLESQVLEKRASEL HQRDVLLTELSNCTVRLYGNPNTLRLTKAHSCKLLCGPVSTSVFLEDCSD CVLAVACQQLRIHSTKDTRIFLQVTSRAIVEDCSGIQFAPYTWSYPEIDK DFESSGLDRSKNNWNDVDDFNWLARDMASPNWSILPEEERNIQWD


    Database link: Q15814

  • Positive control

    • WB: HeLa, NIH/3T3 and A431 whole cell lysates; Mouse brain tissue lysate. IHC-P: Human colon cancer and pancreatic cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235777 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 39 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Tubulin-folding protein; involved in the final step of the tubulin folding pathway.
  • Tissue specificity

    Expressed in the retina. Expressed in the rod and cone photoreceptors, extending from the inner segments (IS), through the outer nuclear layer (ONL) and into the synapses in the outer plexiform layer (OPL). Strongly expressed to the photoreceptor connecting cilium at the tips of the IS (at protein level).
  • Sequence similarities

    Belongs to the TBCC family.
    Contains 1 C-CAP/cofactor C-like domain.
  • Cellular localization

    Cytoplasm. Detected predominantly in the photoreceptor connecting cilium.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta tubulin cofactor C antibody
    • CFC antibody
    • TBCC antibody
    • TBCC_HUMAN antibody
    • Tubulin folding cofactor C antibody
    • Tubulin specific chaperone c antibody
    • Tubulin-folding cofactor C antibody
    • Tubulin-specific chaperone C antibody
    see all

Images

  • Paraffin-embedded human pancreatic cancer tissue stained for TBCC using ab235777 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-TBCC antibody (ab235777) at 1/500 dilution

    Lane 1 : Mouse brain tissue lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : NIH/3T3 (mouse embryo fibroblast cell line) lysate
    Lane 4 : A431 (human epidermoid carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 39 kDa

  • Paraffin-embedded human colon cancer tissue stained for TBCC using ab235777 at 1/100 dilution in immunohistochemical analysis.

References

ab235777 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235777.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up